LEFL3159E12      To the result of BLAST   To the result of InterProScanTo Home
DDBJ Acc. number
AK329870


>LEFL3159E12
GAGCGCAAGTCACACAAAGAACATTTCTTGTGTTATTTGTTAGAAAGAAA
AAAAGAAAGATATGGAGTTGTTGTATGTCTGTCTTGTTTGTGTATTTGTT
TTTTTGGTTTCCCTGTTGCTCTTGTACAAGAAGAAATCCGGAGAAGGGCT
TCCTCCGGGTAAAACAGGGTGGCCTGTATTTGGAGAGAGCCTCGAGTTTC
TGTCGTGTGGTTGGAAAGGCCACCCTGAAAAATTCATCTTTGATCGTGTG
GCTAAGTACTCATCTAGTGTGTTCAAAACTCACCTTCTAGGTGAAGAAGC
TGCGGTTTTTTGTGGTGCATCAGCCAATAAATTCTTATTTTCAAACGAAA
ACAAGTTAGTACAAGCATGGTGGCCAAATTCAGTGAACAAAGTGTTCCCA
TCTTCAACACAAACTTCTTCGAAAGAAGAAGCAATTAAAATGAGAAAAAT
GCTCCCTAATTTTTTCAAACCTGAAGCATTGCAACGTTACGTTGGTATTA
TGGACCACATAACCCAACGTCACTTTGCTTCGGGATGGGAAAATAAAGAG
CAAGTTGTGGTTTTCCCATTAACAAAACGTTACACTTTTTGGTTAGCGTG
TAGATTGTTTTTAAGCGTGGAGGATCCTAAGCATGTAGCAAAATTTGCTG
ACCCATTTGATGTTTTGGCTTCTGGATTGATTTCAATACCTATAGATTTG
CCTGGAACACCGTTCAATCGCGCAATTAAGGCTTCAAATTTTATACGGAA
AGAGCTAGTGAGGATTATAAAACAAAGGAAGATTGATTTAGGTGAGGGGA
AAGTATCATCAACACAAGATATATTGTCACATATGTTGTTAACATGTGAT
GAAAATGGGAAATTTTTGGGGGACTTGGATATTGCTGATAAAATACTAGG
CTTGTTGATTGGTGGACATGATACTGCTAGTTCTGCTTGTTCTTTCATTG
TTAAGTATCTTGCTGAGCTTCCACACATTTATCAACGAGTTTACACAGAG
CAAATGGAGATAGCAAAATCAAAGGGTCCGGGGGAATTATTGAGGTGGGA
AGACATCCAAAAGATGAAATATTCGTGGAATGTGGCATGTGAAGTTTTAA
GACTTGCACCACCTCTCCAAGGTGCTTTTAGGGAAGCCCTTTCTGATTTC
ATGTTCAATGGTTTCTATATACCCAAAGGATGGAAGATTTATTGGAGTGC
AAATTCTACACATAAGAGAGAAGAATTTTTTCCAGATCCAGAAAAATTTG
ACCCATCAAGATTTGAAGGAAGCGGACCAGCTCCATACACATTTGTACCT
TTTGGTGGAGGACCAAGAATGTGTCCAGGAAAAGAATATGCTCGTTTAGA
AATTCTTGTTTTCATGCACCATCTTGTTAAAAGGTTCAAGTTTGAAAAAA
TTATTCCACATGAGAAAATCATAGTCAATCCAATGCCCATTCCCGCCAAC
GGCCTCCCCCTTCGACTCTACCCTCACCACCACAACCCGTGATCCACCAC
CAACAAATTTATTTTATTTCTATTTCTATTTTACATGTGTCTTCACTAAT
AATAATAAATTTGTTTTCCTCCAAAAAAAAAAAAAAAA


HTC vs BAC (C07SLm0141H03.2_reversed)
This is a predicted BAC including this HTC sequence.

KTU3; Kazusa Tomato Unigene ver.3 (KTU3_Singlet45709)  (go to MiBASE)
This is a unigene (KTU3) including this clone as an EST member.






Results of BLAST



To the top of page


Database=nr

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL3159E12gi|147784145|emb|CAN72302.1|emb|CAN72302.1| hypothetical protein [Vitis vinifera]158848076.36478107262147714780770+2
LEFL3159E12gi|157343066|emb|CAO66555.1|emb|CAO66555.1| unnamed protein product [Vitis vinifera]158848075.68477110262147414770769+2
LEFL3159E12gi|157343071|emb|CAO66560.1|emb|CAO66560.1| unnamed protein product [Vitis vinifera]158848076.15478108262147714780769+2
LEFL3159E12gi|157352528|emb|CAO43634.1|emb|CAO43634.1| unnamed protein product [Vitis vinifera]158848073.85478119262147714780753+2
LEFL3159E12gi|84514135|gb|ABC59076.1|gb|ABC59076.1| cytochrome P450 monooxygenase CYP716A12 [Medicago truncatula]158847974.15472118274147764770746+2




To the top of page


Database=UniProt

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL3159E12sp|Q50EK0|C16B2_PICSIsp|Q50EK0|C16B2_PICSI Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1158849751.044802322471477144921e-142506+2
LEFL3159E12sp|Q50EK1|C16B1_PICSIsp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1158849350.424802352471477144929e-142503+2
LEFL3159E12sp|Q8W4T9|T13H_TAXCUsp|Q8W4T9|T13H_TAXCU Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1158848538.41479288656147154821e-97357+2
LEFL3159E12sp|Q9AXM6|T10H_TAXCUsp|Q9AXM6|T10H_TAXCU Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=1158849737.764742905681474234951e-93343+2
LEFL3159E12sp|O81077|ABAH2_ARATHsp|O81077|ABAH2_ARATH Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1158848233.694723108681474224816e-67255+2




To the top of page


Database=TAIR

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL3159E12AT5G36110.1AT5G36110.1 | Symbols: CYP716A1 | CYP716A1 (cytochrome P450, family 716, subfamily A, polypeptide 1); oxygen binding | chr5:14212607-14214843 FORWARD158847762.42479172462147414759e-178620+2
LEFL3159E12AT5G36140.1AT5G36140.1 | Symbols: CYP716A2 | CYP716A2 (cytochrome P450, family 716, subfamily A, polypeptide 2); heme binding / iron ion binding / monooxygenase | chr5:14229442-14230489 REVERSE158831858.12320128471101213151e-100363+2
LEFL3159E12AT2G42850.1AT2G42850.1 | Symbols: CYP718 | CYP718 (cytochrome P450, family 718); oxygen binding | chr2:17838739-17840386 FORWARD158848531.514763138861474144822e-68256+2
LEFL3159E12AT2G29090.1AT2G29090.1 | Symbols: CYP707A2 | CYP707A2 (cytochrome P450, family 707, subfamily A, polypeptide 2); oxygen binding | chr2:12502115-12506157 REVERSE158848233.694723108681474224816e-68255+2
LEFL3159E12AT5G45340.1AT5G45340.1 | Symbols: CYP707A3 | CYP707A3 (cytochrome P450, family 707, subfamily A, polypeptide 3); oxygen binding | chr5:18386204-18388136 REVERSE158846333.954833061059146824594e-66249+2




To the top of page


Database=RAP

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL3159E12Os07g0518500|AK099924Os07g0518500|AK099924 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002401 : E-class P450, group I;Representative_sequence AK099924158848336.97476296459147424749e-85311+2
LEFL3159E12Os07g0518100|AK105659Os07g0518100|AK105659 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002401 : E-class P450, group I;Representative_sequence AK105659158849236.57484292868147494882e-84310+2
LEFL3159E12Os07g0519500|Os07g0519500Os07g0519500|Os07g0519500 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002401 : E-class P450, group I;Representative_sequence Os07g0519500158843037.3429268374135734283e-81299+2
LEFL3159E12Os07g0520300|AK109627Os07g0520300|AK109627 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002403 : E-class P450, group IV;Representative_sequence AK109627158849836.124792947681468104852e-80297+2
LEFL3159E12Os07g0519300|AK073618Os07g0519300|AK073618 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002401 : E-class P450, group I;Representative_sequence AK073618158840738.293972434284146833961e-76284+2




To the top of page


Database=SGN Tomato UniGene

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL3159E12SGN-U345855SGN-U345855 Tomato 200607 #1 [1 ESTs aligned] arabidopsis/peptide: AT5G36110.1 | Symbol: None | cytochrome P450 family protein, similar to taxane 13-alpha-hydroxylase (GI:17148242) {Taxus cuspidata}; contains Pfam profile: PF00067: Cytochrome P450 | chr5:14212607-14214843 FORWARD | Aliases: MAB16.5, MAB16_5 (evalue: 1e-85, score=312) genbank/nr: cytochrome(evalue: 2e-105, score=385)158856899.47568306641231156801102Plus
LEFL3159E12SGN-U326723SGN-U326723 Tomato 200607 #1 [4 ESTs aligned] arabidopsis/peptide: AT5G36110.1 | Symbol: None | cytochrome P450 family protein, similar to taxane 13-alpha-hydroxylase (GI:17148242) {Taxus cuspidata}; contains Pfam profile: PF00067: Cytochrome P450 | chr5:14212607-14214843 FORWARD | Aliases: MAB16.5, MAB16_5 (evalue: 7e-101, score=364) genbank/nr: gi|24745923|dbj|BAC23044.1| cytochrome P450 [Solanum tuberosum](evalue: 0, score=912)1588157583.529115012471337120012900.0000000161.9Plus




To the top of page


Database=DFCI Tomato Gene Index

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL3159E12TC215989TC215989 similar to UniRef100_A7PFF0 Cluster: Chromosome chr11 scaffold_14, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr11 scaffold_14, whole genome shotgun sequence - Vitis vinifera (Grape), partial (72%)1588118899.411188611311991118802292Plus






Results of InterProScan



To the top of page


SEQUENCE: LEFL3159E12_1_ORF1 CRC64: 126A7E3F5FA6B34D LENGTH: 53 aa
>LEFL3159E12_1_ORF1 Translation of LEFL3159E12 in frame 1, ORF 1, threshold 50, 53aa
ERKSHKEHFLCYLLERKKERYGVVVCLSCLCICFFGFPVALVQEEIRRRASSG
No hits reported.

SEQUENCE: LEFL3159E12_1_ORF2 CRC64: EFF5C1CC91E379DF LENGTH: 58 aa
>LEFL3159E12_1_ORF2 Translation of LEFL3159E12 in frame 1, ORF 2, threshold 50, 59aa
ENHSQSNAHSRQRPPPSTLPSPPQPVIHHQQIYFISISILHVSSLIIINLFSSKKKKK
noIPR
unintegrated
unintegrated
seg [10-25]? NA seg seg[35-48]? NA seg seg seg

SEQUENCE: LEFL3159E12_1_ORF2 CRC64: EFF5C1CC91E379DF LENGTH: 58 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [10-25]?   NA [35-48]?     
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL3159E12_2_ORF2 CRC64: 4CB8A6CEB832FA52 LENGTH: 482 aa
>LEFL3159E12_2_ORF2 Translation of LEFL3159E12 in frame 2, ORF 2, threshold 50, 482aa
KEKKKDMELLYVCLVCVFVFLVSLLLLYKKKSGEGLPPGKTGWPVFGESLEFLSCGWKGH
PEKFIFDRVAKYSSSVFKTHLLGEEAAVFCGASANKFLFSNENKLVQAWWPNSVNKVFPS
STQTSSKEEAIKMRKMLPNFFKPEALQRYVGIMDHITQRHFASGWENKEQVVVFPLTKRY
TFWLACRLFLSVEDPKHVAKFADPFDVLASGLISIPIDLPGTPFNRAIKASNFIRKELVR
IIKQRKIDLGEGKVSSTQDILSHMLLTCDENGKFLGDLDIADKILGLLIGGHDTASSACS
FIVKYLAELPHIYQRVYTEQMEIAKSKGPGELLRWEDIQKMKYSWNVACEVLRLAPPLQG
AFREALSDFMFNGFYIPKGWKIYWSANSTHKREEFFPDPEKFDPSRFEGSGPAPYTFVPF
GGGPRMCPGKEYARLEILVFMHHLVKRFKFEKIIPHEKIIVNPMPIPANGLPLRLYPHHH
NP
InterPro
IPR001128
Family
Cytochrome P450
PR00385 [290-307]T 4e-08 PR00385 P450[346-357]T 4e-08 PR00385 P450[418-427]T 4e-08 PR00385 P450[427-438]T 4e-08 PR00385 P450 P450
G3DSA:1.10.630.10 [21-478]T 1.7e-87 G3DSA:1.10.630.10 no description no description
PTHR19383 [10-448]T 1.1e-191 PTHR19383 CYTOCHROME P450 CYTOCHROME P450
PF00067 [222-451]T 1.9e-48 PF00067 p450 p450
PS00086 [420-429]? NA PS00086 CYTOCHROME_P450 CYTOCHROME_P450
SSF48264 [37-477]T 1.5e-95 SSF48264 Cytochrome P450 Cytochrome P450
InterPro
IPR002401
Family
Cytochrome P450, E-class, group I
PR00463 [279-296]T 6.3e-15 PR00463 EP450I[299-325]T 6.3e-15 PR00463 EP450I[385-409]T 6.3e-15 PR00463 EP450I[417-427]T 6.3e-15 PR00463 EP450I[427-450]T 6.3e-15 PR00463 EP450I EP450I
noIPR
unintegrated
unintegrated
PTHR19383:SF25 [10-448]T 1.1e-191 PTHR19383:SF25 CYTOCHROME P450 CYTOCHROME P450
seg [8-36]? NA seg seg seg

SEQUENCE: LEFL3159E12_2_ORF2 CRC64: 4CB8A6CEB832FA52 LENGTH: 482 aa
InterPro
IPR001128
Family
Cytochrome P450
PRINTSPR00385P450
 4e-08 [290-307]T   4e-08 [346-357]T   4e-08 [418-427]T   4e-08 [427-438]T 
GENE3DG3DSA:1.10.630.10no description
 1.7e-87 [21-478]T       
PANTHERPTHR19383CYTOCHROME P450
 1.1e-191 [10-448]T       
PFAMPF00067p450
 1.9e-48 [222-451]T       
PROSITEPS00086CYTOCHROME_P450
 NA [420-429]?       
SUPERFAMILYSSF48264Cytochrome P450
 1.5e-95 [37-477]T       
Parent no parent
Children IPR002397 IPR002399 IPR002401 IPR002402 IPR002403
Found in no entries
Contains no entries
GO terms Molecular Function: monooxygenase activity (GO:0004497)
Molecular Function: iron ion binding (GO:0005506)
Biological Process: electron transport (GO:0006118)
Molecular Function: heme binding (GO:0020037)
InterPro
IPR002401
Family
Cytochrome P450, E-class, group I
PRINTSPR00463EP450I
 6.3e-15 [279-296]T   6.3e-15 [299-325]T   6.3e-15 [385-409]T   6.3e-15 [417-427]T 
 6.3e-15 [427-450]T       
Parent IPR001128
Children IPR002949 IPR002974 IPR008066 IPR008067 IPR008068 IPR008069 IPR008070 IPR008071 IPR008072
Found in no entries
Contains no entries
GO terms Molecular Function: monooxygenase activity (GO:0004497)
Molecular Function: iron ion binding (GO:0005506)
Biological Process: electron transport (GO:0006118)
Molecular Function: heme binding (GO:0020037)
noIPR
unintegrated
unintegrated
PANTHERPTHR19383:SF25CYTOCHROME P450
 1.1e-191 [10-448]T       
SEGseg seg
 NA [8-36]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL3159E12_3_ORF1 CRC64: 37B2A6833F9FD0BA LENGTH: 95 aa
>LEFL3159E12_3_ORF1 Translation of LEFL3159E12 in frame 3, ORF 1, threshold 50, 95aa
AQVTQRTFLVLFVRKKKRKIWSCCMSVLFVYLFFWFPCCSCTRRNPEKGFLRVKQGGLYL
ERASSFCRVVGKATLKNSSLIVWLSTHLVCSKLTF
No hits reported.

SEQUENCE: LEFL3159E12_3_ORF2 CRC64: 440D4F904953BFD6 LENGTH: 82 aa
>LEFL3159E12_3_ORF2 Translation of LEFL3159E12 in frame 3, ORF 2, threshold 50, 82aa
DLHHLSKVLLGKPFLISCSMVSIYPKDGRFIGVQILHIREKNFFQIQKNLTHQDLKEADQ
LHTHLYLLVEDQECVQEKNMLV
No hits reported.

SEQUENCE: LEFL3159E12_3_ORF3 CRC64: 288C21E2EC19A980 LENGTH: 54 aa
>LEFL3159E12_3_ORF3 Translation of LEFL3159E12 in frame 3, ORF 3, threshold 50, 54aa
SIQCPFPPTASPFDSTLTTTTRDPPPTNLFYFYFYFTCVFTNNNKFVFLQKKKK
noIPR
unintegrated
unintegrated
seg [9-27]? NA seg seg[30-36]? NA seg seg seg

SEQUENCE: LEFL3159E12_3_ORF3 CRC64: 288C21E2EC19A980 LENGTH: 54 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [9-27]?   NA [30-36]?     
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL3159E12_4_ORF2 CRC64: ECB739436F25B288 LENGTH: 92 aa
>LEFL3159E12_4_ORF2 Translation of LEFL3159E12 in frame 4, ORF 2, threshold 50, 92aa
SRRGRPLAGMGIGLTMIFSCGIIFSNLNLLTRWCMKTRISKRAYSFPGHILGPPPKGTNV
YGAGPLPSNLDGSNFSGSGKNSSLLCVEFALQ
noIPR
unintegrated
unintegrated
seg [72-83]? NA seg seg seg

SEQUENCE: LEFL3159E12_4_ORF2 CRC64: ECB739436F25B288 LENGTH: 92 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [72-83]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL3159E12_4_ORF3 CRC64: 66E3CB7B9C01125C LENGTH: 57 aa
>LEFL3159E12_4_ORF3 Translation of LEFL3159E12 in frame 4, ORF 3, threshold 50, 57aa
KPLNMKSERASLKAPWRGGASLKTSHATFHEYFIFWMSSHLNNSPGPFDFAISICSV
No hits reported.

SEQUENCE: LEFL3159E12_4_ORF4 CRC64: 556FC53AA8D87AE1 LENGTH: 132 aa
>LEFL3159E12_4_ORF4 Translation of LEFL3159E12 in frame 4, ORF 4, threshold 50, 132aa
MCGSSARYLTMKEQAELAVSCPPINKPSILSAISKSPKNFPFSSHVNNICDNISCVDDTF
PSPKSIFLCFIILTSSFRIKFEALIARLNGVPGKSIGIEINPEAKTSNGSANFATCLGSS
TLKNNLHANQKV
No hits reported.

SEQUENCE: LEFL3159E12_4_ORF5 CRC64: 4548B22D61D27BB9 LENGTH: 68 aa
>LEFL3159E12_4_ORF5 Translation of LEFL3159E12 in frame 4, ORF 5, threshold 50, 68aa
RCNASGLKKLGSIFLILIASSFEEVCVEDGNTLFTEFGHHACTNLFSFENKNLLADAPQK
TAASSPRR
No hits reported.

SEQUENCE: LEFL3159E12_4_ORF6 CRC64: F44438EAE7A3E8F7 LENGTH: 79 aa
>LEFL3159E12_4_ORF6 Translation of LEFL3159E12 in frame 4, ORF 6, threshold 50, 79aa
VLNTLDEYLATRSKMNFSGWPFQPHDRNSRLSPNTGHPVLPGGSPSPDFFLYKSNRETKK
TNTQTRQTYNNSISFFFSF
No hits reported.

SEQUENCE: LEFL3159E12_5_ORF2 CRC64: A3F01EFE1C1CD75F LENGTH: 55 aa
>LEFL3159E12_5_ORF2 Translation of LEFL3159E12 in frame 5, ORF 2, threshold 50, 55aa
NKFVGGGSRVVVVRVESKGEAVGGNGHWIDYDFLMWNNFFKLEPFNKMVHENKNF
noIPR
unintegrated
unintegrated
seg [4-22]? NA seg seg seg

SEQUENCE: LEFL3159E12_5_ORF2 CRC64: A3F01EFE1C1CD75F LENGTH: 55 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [4-22]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL3159E12_5_ORF3 CRC64: 385CB6B81CDF31AC LENGTH: 52 aa
>LEFL3159E12_5_ORF3 Translation of LEFL3159E12 in frame 5, ORF 3, threshold 50, 52aa
WVKFFWIWKKFFSLMCRICTPINLPSFGYIETIEHEIRKGFPKSTLERWCKS
noIPR
unintegrated
unintegrated
seg [1-12]? NA seg seg seg

SEQUENCE: LEFL3159E12_5_ORF3 CRC64: 385CB6B81CDF31AC LENGTH: 52 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [1-12]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL3159E12_5_ORF4 CRC64: 7D996DAB5794ADE9 LENGTH: 54 aa
>LEFL3159E12_5_ORF4 Translation of LEFL3159E12 in frame 5, ORF 4, threshold 50, 54aa
WENHNLLFIFPSRSKVTLGYVVHNTNVTLQCFRFEKIREHFSHFNCFFFRRSLC
No hits reported.

SEQUENCE: LEFL3159E12_5_ORF5 CRC64: 1B133E4BF5794C66 LENGTH: 86 aa
>LEFL3159E12_5_ORF5 Translation of LEFL3159E12 in frame 5, ORF 5, threshold 50, 87aa
VLSHTIKDEFFRVAFPTTRQKLEALSKYRPPCFTRRKPFSGFLLVQEQQGNQKNKYTNKT
DIQQLHIFLFFFLTNNTRNVLCVTCA
noIPR
unintegrated
unintegrated
seg [68-77]? NA seg seg seg

SEQUENCE: LEFL3159E12_5_ORF5 CRC64: 1B133E4BF5794C66 LENGTH: 86 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [68-77]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL3159E12_6_ORF2 CRC64: 891A2F32087327FF LENGTH: 51 aa
>LEFL3159E12_6_ORF2 Translation of LEFL3159E12 in frame 6, ORF 2, threshold 50, 51aa
KQEFLNEHILFLDTFLVLHQKVQMCMELVRFLQILMGQIFLDLEKILLSYV
No hits reported.

SEQUENCE: LEFL3159E12_6_ORF3 CRC64: 38056951BC402EA9 LENGTH: 58 aa
>LEFL3159E12_6_ORF3 Translation of LEFL3159E12 in frame 6, ORF 3, threshold 50, 58aa
KHLGEVVQVLKLHMPHSTNISSFGCLPTSIIPPDPLILLSPFALCKLVDKCVEAQQDT
noIPR
unintegrated
unintegrated
seg [26-41]? NA seg seg seg

SEQUENCE: LEFL3159E12_6_ORF3 CRC64: 38056951BC402EA9 LENGTH: 58 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [26-41]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL3159E12_6_ORF4 CRC64: C56121C7F4C985A8 LENGTH: 53 aa
>LEFL3159E12_6_ORF4 Translation of LEFL3159E12 in frame 6, ORF 4, threshold 50, 53aa
QYHVHQSTSLVFYQQYPSPPKISHFHHMLTTYVTIYLVLMILSPHLNQSSFVL
No hits reported.

SEQUENCE: LEFL3159E12_6_ORF5 CRC64: 933B078D19038202 LENGTH: 53 aa
>LEFL3159E12_6_ORF5 Translation of LEFL3159E12 in frame 6, ORF 5, threshold 50, 53aa
LLLLSKKFVLKMGTLCSLNLATMLVLTCFRLKIRIYWLMHHKKPQLLHLEGEF
No hits reported.

SEQUENCE: LEFL3159E12_6_ORF6 CRC64: 2F920781DD848D10 LENGTH: 66 aa
>LEFL3159E12_6_ORF6 Translation of LEFL3159E12 in frame 6, ORF 6, threshold 50, 66aa
IFQGGLSNHTTETRGSLQIQATLFYPEEALLRISSCTRATGKPKKQIHKQDRHTTTPYLS
FFLSNK
No hits reported.