LEFL2046F14      To the result of BLAST   To the result of InterProScanTo Home
DDBJ Acc. number
AK328092


>LEFL2046F14
CAATATTTTTATATTATCATAGTAATATTTATCTAATTTTTAGGACCACT
TATTACTAAATAATAAATTAACTACTACTATATTATTGTTGTGAAACAAC
AACGTTTTGGTTGTTATGATGAAACGTACACTATATCAGTATGAAAAATT
CAAAACGATTAGTATAAATTATATTGAAAATTTGATATTTTTCTATTCTT
AATCAGACGTATTGGGTTTCATATTTTAAAAAGGGACTAAACTTAGAAGA
GAAGTTTGTTTGAAACTACTTTTGTCTCTTTCTTGTTCCCATTTCTCTCT
TAGATTTCAAAAAGTGAACTACTTTATCTCTTTCTTTGTTCACATTTTAT
TTTATTCTATTATAAATATGGCATCCTCATATTGAGATTTTTAGAAATTA
TTCTAATCATTCACAGTGCAAAAGAAGATGGAAAGCCCTAGAGTTGAGGA
GAGTTATGACAAAATGAGTGAATTAAAAGCGTTTGATGATACTAAGGCCG
GTGTTAAAGGACTTGTTGATTCTGGAATTACTAAAGTACCTCAAATATTC
GTTCTACCGCCAAAAGACAGGGCTAAAAAATGTGAAACACATTTCGTTTT
TCCAGTGATAGACCTTCAAGGTATCGATGAGGATCCGATTAAGCATAAGG
AGATAGTGGACAAAGTTCGAGATGCATCGGAGAAATGGGGTTTTTTCCAA
GTGGTTAATCATGGGATTCCAACATCCGTCTTGGACAGAACGTTGCAAGG
AACACGACAGTTCTTTGAGCAAGATAACGAGGTTAAGAAACAGTATTACA
CTCGAGATACTGCGAAAAAAGTGGTTTATACTAGCAATCTTGATTTGTAT
AAATCTTCTGTTCCAGCTGCAAGTTGGAGAGACACGATTTTCTGTTACAT
GGCTCCGAATCCTCCCAGTCTACAAGAATTTCCAACTCCATGCGGGGAGT
CATTAATAGACTTCTCCAAGGATGTGAAGAAACTGGGATTCACTTTACTT
GAATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTA
TATGGATTGTTTTCATCTTTTCTGTTCTTGCAACTACTACCCACCATGTC
CTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGTTTT
GTAACGATCCTTCTACAAGATGATATGGGAGGGCTCCAAGTTCTTCACCA
GAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCTCTAGTGGTGAATA
TTGGAGATTTTCTGCAGCTCTTGTCAAATGACAAGTACTTAAGTGTCGAG
CACAGAGCAATCTCAAACAATGTTGGATCAAGAATGTCAATCACGTGCTT
CTTCGGTGAAAGTCCATATCAATCTTCCAAGCTTTATGGACCGATAACTG
AATTGTTATCAGAAGATAATCCTCCAAAATATCGCGCAACCACAGTGAAA
GACCACACTAGTTACCTCCATAACAGAGGCCTAGATGGAACTTCTGCATT
GTCCCGTTACAAGATCTAAGAATAAGAATAATAATGTTATCTATTATTAC
TATTTATACTTCTGCAGATTGTACCTTTGAATTTGAAGCAAATGTTTGAG
TTAAATACTTTCACGTTTCTAAGCAATGTAATATAATTTATAAAGTATGT
GCTTGCTATATATTGTTGTTTAAAACATTAAATAATATTACATAAATATA
AACACCATAATATAAGGATGTTTAGCATTGTGGGAAAAAAAAAAAAAAAA



No predicted BACs including this HTC sequence.

KTU3; Kazusa Tomato Unigene ver.3 (KTU3_Contig30266)  (go to MiBASE)
This is a unigene (KTU3) including this clone as an EST member.






Results of BLAST



To the top of page


Database=nr

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2046F14gi|119640|sp|P10967.1|ACCH3_SOLLCsp|P10967.1|ACCH3_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog; AltName: Full=Protein E8///emb|CAA31789.1| E8 protein [Solanum lycopersicum]175036310036300428151613630751+2
LEFL2046F14gi|2218141|gb|AAB71139.1|gb|AAB71139.1| E8 protein homolog [Lycopersicon esculentum]175036477.37358810443151673641e-163580+2
LEFL2046F14gi|147807864|emb|CAN66433.1|emb|CAN66433.1| hypothetical protein [Vitis vinifera]175036558.6635814654491516123651e-124451+2
LEFL2046F14gi|157336666|emb|CAO71351.1|emb|CAO71351.1| unnamed protein product [Vitis vinifera]175036358.613601484440151683632e-124450+2
LEFL2046F14gi|157336661|emb|CAO71346.1|emb|CAO71346.1| unnamed protein product [Vitis vinifera]175036558.6635814654491516123653e-122442+2




To the top of page


Database=UniProt

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2046F14sp|P10967|ACCH3_SOLLCsp|P10967|ACCH3_SOLLC 1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1175036310036300428151613630751+2
LEFL2046F14sp|Q84MB3|ACCH1_ARATHsp|Q84MB3|ACCH1_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1175036554.0635716044581516123652e-112406+2
LEFL2046F14sp|Q9C5K7|ACCH2_ARATHsp|Q9C5K7|ACCH2_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 2 OS=Arabidopsis thaliana GN=At1g06640 PE=2 SV=1175036948.663721826428151613692e-102373+2
LEFL2046F14sp|Q8H1S4|ACCH3_ARATHsp|Q8H1S4|ACCH3_ARATH 1-aminocyclopropane-1-carboxylate oxidase homolog 4 OS=Arabidopsis thaliana GN=At1g06650 PE=2 SV=1175036948.393721836428151613694e-101369+2
LEFL2046F14sp|O04847|DV4H_CATROsp|O04847|DV4H_CATRO Deacetoxyvindoline 4-hydroxylase OS=Catharanthus roseus GN=D4H PE=1 SV=2175040149.5936317374581516403997e-95348+2




To the top of page


Database=TAIR

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2046F14AT1G06620.1AT1G06620.1 | Symbols: | 2-oxoglutarate-dependent dioxygenase, putative | chr1:2025617-2027093 FORWARD175036554.0635716044581516123652e-113406+2
LEFL2046F14AT5G59530.1AT5G59530.1 | Symbols: | 2-oxoglutarate-dependent dioxygenase, putative | chr5:24011660-24012941 REVERSE175036451.533591696455151683643e-104375+2
LEFL2046F14AT1G04350.1AT1G04350.1 | Symbols: | 2-oxoglutarate-dependent dioxygenase, putative | chr1:1165295-1166537 FORWARD175036051.13621716449151643605e-104375+2
LEFL2046F14AT1G06640.1AT1G06640.1 | Symbols: | 2-oxoglutarate-dependent dioxygenase, putative | chr1:2032365-2033774 FORWARD175036948.663721826428151613692e-103373+2
LEFL2046F14AT1G06650.2AT1G06650.2 | Symbols: | 2-oxoglutarate-dependent dioxygenase, putative | chr1:2035908-2037185 FORWARD175036948.393721836428151613694e-102369+2




To the top of page


Database=RAP

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2046F14Os04g0182200|AK067970Os04g0182200|AK067970 2OG-Fe(II) oxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence AK067970175037546.4937018374521516143754e-90329+2
LEFL2046F14Os03g0690500|Os03g0690500Os03g0690500|Os03g0690500 2OG-Fe(II) oxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence Os03g0690500175037345.63641876458151683668e-84308+2
LEFL2046F14Os03g0860600|AK071828Os03g0860600|AK071828 Similar to 2-oxoglutarate-dependent oxygenase.;category II : Similar to known protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence AK071828175036145.533581909458151683533e-78290+2
LEFL2046F14Os08g0392100|Os08g0392100Os08g0392100|Os08g0392100 2OG-Fe(II) oxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence Os08g0392100175037644.93631908458151683643e-76283+2
LEFL2046F14Os08g0390200|AK068286Os08g0390200|AK068286 Similar to 2-oxoglutarate-dependent oxygenase.;category II : Similar to known protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence AK068286175039643.823721929458152283736e-76282+2




To the top of page


Database=SGN Tomato UniGene

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL2046F14SGN-U314505SGN-U314505 Tomato 200607 #1 [510 ESTs aligned] arabidopsis/peptide: AT1G06620.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP:P10967); contains Pfam profile: PF00671 Iron/Ascorbate oxidoreductase family | chr1:2025600-2027270 FORWARD | Aliases: F12K11.24, F12K11_24 (evalue: 1e-106, score=383) genbank/nr: gi|19199|emb|CAA31789.1| E8 protein [Lycopersicon esculentum] >gi|119640|sp|P10967|ACCO3_LYCES 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) (evalue: 0, score=718)1750148299.26135961393174714137202613Plus
LEFL2046F14SGN-U314506SGN-U314506 Tomato 200607 #1 [35 ESTs aligned] arabidopsis/peptide: AT1G06620.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP:P10967); contains Pfam profile: PF00671 Iron/Ascorbate oxidoreductase family | chr1:2025600-2027270 FORWARD | Aliases: F12K11.24, F12K11_24 (evalue: 5e-51, score=199) genbank/nr: gi|19199|emb|CAA31789.1| E8 protein [Lycopersicon esculentum] >gi|119640|sp|P10967|ACCO3_LYCES 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) (evalue: 2e-97, score=359)1750147410072900217945172901445Plus
LEFL2046F14SGN-U314506SGN-U314506 Tomato 200607 #1 [35 ESTs aligned] arabidopsis/peptide: AT1G06620.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP:P10967); contains Pfam profile: PF00671 Iron/Ascorbate oxidoreductase family | chr1:2025600-2027270 FORWARD | Aliases: F12K11.24, F12K11_24 (evalue: 5e-51, score=199) genbank/nr: gi|19199|emb|CAA31789.1| E8 protein [Lycopersicon esculentum] >gi|119640|sp|P10967|ACCO3_LYCES 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) (evalue: 2e-97, score=359)1750147498.93563609401502912147401070Plus
LEFL2046F14SGN-U314497SGN-U314497 Tomato 200607 #1 [14 ESTs aligned] arabidopsis/peptide: AT1G06620.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP:P10967); contains Pfam profile: PF00671 Iron/Ascorbate oxidoreductase family | chr1:2025600-2027270 FORWARD | Aliases: F12K11.24, F12K11_24 (evalue: 1e-78, score=216) genbank/nr: gi|19199|emb|CAA31789.1| E8 protein [Lycopersicon esculentum] >gi|119640|sp|P10967|ACCO3_LYCES 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) (evalue: 1e-146, score=367)17501001100567007011267156701124Plus
LEFL2046F14SGN-U314497SGN-U314497 Tomato 200607 #1 [14 ESTs aligned] arabidopsis/peptide: AT1G06620.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP:P10967); contains Pfam profile: PF00671 Iron/Ascorbate oxidoreductase family | chr1:2025600-2027270 FORWARD | Aliases: F12K11.24, F12K11_24 (evalue: 1e-78, score=216) genbank/nr: gi|19199|emb|CAA31789.1| E8 protein [Lycopersicon esculentum] >gi|119640|sp|P10967|ACCO3_LYCES 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) (evalue: 1e-146, score=367)1750100199.7438810125716445869730761Plus
LEFL2046F14SGN-U314496SGN-U314496 Tomato 200607 #1 [11 ESTs aligned] arabidopsis/peptide: AT1G06620.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP:P10967); contains Pfam profile: PF00671 Iron/Ascorbate oxidoreductase family | chr1:2025600-2027270 FORWARD | Aliases: F12K11.24, F12K11_24 (evalue: 9e-47, score=185) genbank/nr: gi|19199|emb|CAA31789.1| E8 protein [Lycopersicon esculentum] >gi|119640|sp|P10967|ACCO3_LYCES 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) (evalue: 3e-95, score=352)1750189599.6252720420946152701029Plus
LEFL2046F14SGN-U314496SGN-U314496 Tomato 200607 #1 [11 ESTs aligned] arabidopsis/peptide: AT1G06620.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP:P10967); contains Pfam profile: PF00671 Iron/Ascorbate oxidoreductase family | chr1:2025600-2027270 FORWARD | Aliases: F12K11.24, F12K11_24 (evalue: 9e-47, score=185) genbank/nr: gi|19199|emb|CAA31789.1| E8 protein [Lycopersicon esculentum] >gi|119640|sp|P10967|ACCO3_LYCES 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) (evalue: 3e-95, score=352)1750189599.753931012571649133717290771Plus
LEFL2046F14SGN-U314496SGN-U314496 Tomato 200607 #1 [11 ESTs aligned] arabidopsis/peptide: AT1G06620.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP:P10967); contains Pfam profile: PF00671 Iron/Ascorbate oxidoreductase family | chr1:2025600-2027270 FORWARD | Aliases: F12K11.24, F12K11_24 (evalue: 9e-47, score=185) genbank/nr: gi|19199|emb|CAA31789.1| E8 protein [Lycopersicon esculentum] >gi|119640|sp|P10967|ACCO3_LYCES 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) (evalue: 3e-95, score=352)1750189599.732810940126794412710642Plus
LEFL2046F14SGN-U338746SGN-U338746 Tomato 200607 #1 [1 ESTs aligned] arabidopsis/peptide: AT5G59530.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP:P10967); 1-aminocyclopropane-1-carboxylate oxidase kidney bean, PIR:T10818 | chr5:24011410-24012941 REVERSE | Aliases: F2O15.26, F2O15_26 (evalue: 3e-50, score=196) genbank/nr: gi|19199|emb|CAA31789.1| E8 protein [Lycopersicon esculentum] >gi|119640|sp|P10967|ACCO3_LYCES 1-aminocyclopropane-1-carboxylate oxidase homolog (Protein E8) (evalue: 7e-92, score=340)1750616100514009961509151401019Plus




To the top of page


Database=DFCI Tomato Gene Index

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL2046F14TC193327TC193327 UniRef100_P10967 Cluster: 1-aminocyclopropane-1-carboxylate oxidase homolog; n=1; Solanum lycopersicum|Rep: 1-aminocyclopropane-1-carboxylate oxidase homolog - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), complete1750140410013480040017472134902672Plus
LEFL2046F14TC215142TC215142 UniRef100_P10967 Cluster: 1-aminocyclopropane-1-carboxylate oxidase homolog; n=1; Solanum lycopersicum|Rep: 1-aminocyclopropane-1-carboxylate oxidase homolog - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), partial (63%)1750113099.181098812111181109702113Plus
LEFL2046F14TC200045TC200045 UniRef100_P10967 Cluster: 1-aminocyclopropane-1-carboxylate oxidase homolog; n=1; Solanum lycopersicum|Rep: 1-aminocyclopropane-1-carboxylate oxidase homolog - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), partial (77%)1750952100875003931267387701735Plus
LEFL2046F14TC192538TC192538 UniRef100_P10967 Cluster: 1-aminocyclopropane-1-carboxylate oxidase homolog; n=1; Solanum lycopersicum|Rep: 1-aminocyclopropane-1-carboxylate oxidase homolog - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), complete1750126799.888551041312671486801687Plus
LEFL2046F14TC192538TC192538 UniRef100_P10967 Cluster: 1-aminocyclopropane-1-carboxylate oxidase homolog; n=1; Solanum lycopersicum|Rep: 1-aminocyclopropane-1-carboxylate oxidase homolog - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), complete1750126799.71349101257160588712350684Plus
LEFL2046F14TC202303TC202303 homologue to UniRef100_P10967 Cluster: 1-aminocyclopropane-1-carboxylate oxidase homolog; n=1; Solanum lycopersicum|Rep: 1-aminocyclopropane-1-carboxylate oxidase homolog - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), partial (38%)175072899.4572440117840272501411Plus






Results of InterProScan



To the top of page


SEQUENCE: LEFL2046F14_2_ORF2 CRC64: 41F7415EEC50C175 LENGTH: 51 aa
>LEFL2046F14_2_ORF2 Translation of LEFL2046F14 in frame 2, ORF 2, threshold 50, 51aa
KGTKLRREVCLKLLLSLSCSHFSLRFQKVNYFISFFVHILFYSIINMASSY
noIPR
unintegrated
unintegrated
seg [11-24]? NA seg seg seg

SEQUENCE: LEFL2046F14_2_ORF2 CRC64: 41F7415EEC50C175 LENGTH: 51 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [11-24]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2046F14_2_ORF3 CRC64: 5E10C58CF57E86A9 LENGTH: 370 aa
>LEFL2046F14_2_ORF3 Translation of LEFL2046F14 in frame 2, ORF 3, threshold 50, 370aa
SFTVQKKMESPRVEESYDKMSELKAFDDTKAGVKGLVDSGITKVPQIFVLPPKDRAKKCE
THFVFPVIDLQGIDEDPIKHKEIVDKVRDASEKWGFFQVVNHGIPTSVLDRTLQGTRQFF
EQDNEVKKQYYTRDTAKKVVYTSNLDLYKSSVPAASWRDTIFCYMAPNPPSLQEFPTPCG
ESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYYPPCPQPELTMGT
IQHTDIGFVTILLQDDMGGLQVLHQNHWVDVPPTPGSLVVNIGDFLQLLSNDKYLSVEHR
AISNNVGSRMSITCFFGESPYQSSKLYGPITELLSEDNPPKYRATTVKDHTSYLHNRGLD
GTSALSRYKI
InterPro
IPR005123
Domain
2OG-Fe(II) oxygenase
PF03171 [219-318]T 1.1e-43 PF03171 2OG-FeII_Oxy 2OG-FeII_Oxy
noIPR
unintegrated
unintegrated
G3DSA:2.60.120.330 [27-369]T 8.4e-97 G3DSA:2.60.120.330 no description no description
PTHR10209 [77-370]T 7e-146 PTHR10209 IRON/ASCORBATE-DEPENDENT OXIDOREDUCTASE FAMILY MEMBER IRON/ASCORBATE-DEPENDENT OXIDOREDUCTASE FAMILY MEMBER
PTHR10209:SF23 [77-370]T 7e-146 PTHR10209:SF23 1-AMINOCYCLOPROPANE-1-CARBOXYLATE OXIDASE 1-AMINOCYCLOPROPANE-1-CARBOXYLATE OXIDASE
seg [193-207]? NA seg seg seg
SSF51197 [28-363]T 1.1e-95 SSF51197 Clavaminate synthase-like Clavaminate synthase-like

SEQUENCE: LEFL2046F14_2_ORF3 CRC64: 5E10C58CF57E86A9 LENGTH: 370 aa
InterPro
IPR005123
Domain
2OG-Fe(II) oxygenase
PFAMPF031712OG-FeII_Oxy
 1.1e-43 [219-318]T       
Parent no parent
Children IPR006620
Found in IPR002283 IPR004574
Contains IPR002057
GO terms none
noIPR
unintegrated
unintegrated
GENE3DG3DSA:2.60.120.330no description
 8.4e-97 [27-369]T       
PANTHERPTHR10209IRON/ASCORBATE-DEPENDENT OXIDOREDUCTASE FAMILY MEMBER
 7e-146 [77-370]T       
PANTHERPTHR10209:SF231-AMINOCYCLOPROPANE-1-CARBOXYLATE OXIDASE
 7e-146 [77-370]T       
SEGseg seg
 NA [193-207]?       
SUPERFAMILYSSF51197Clavaminate synthase-like
 1.1e-95 [28-363]T       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2046F14_3_ORF2 CRC64: 282434412AE129F0 LENGTH: 99 aa
>LEFL2046F14_3_ORF2 Translation of LEFL2046F14 in frame 3, ORF 2, threshold 50, 99aa
WTKFEMHRRNGVFSKWLIMGFQHPSWTERCKEHDSSLSKITRLRNSITLEILRKKWFILA
ILICINLLFQLQVGETRFSVTWLRILPVYKNFQLHAGSH
No hits reported.

SEQUENCE: LEFL2046F14_3_ORF3 CRC64: 91BD8B2A639C5350 LENGTH: 58 aa
>LEFL2046F14_3_ORF3 Translation of LEFL2046F14 in frame 3, ORF 3, threshold 50, 58aa
RNWDSLYLNYCLKVSVSIVVISKIIWIVFIFSVLATTTHHVLSQNSPWAPFNIPILVL
noIPR
unintegrated
unintegrated
seg [13-33]? NA seg seg seg

SEQUENCE: LEFL2046F14_3_ORF3 CRC64: 91BD8B2A639C5350 LENGTH: 58 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [13-33]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2046F14_4_ORF2 CRC64: 1C7B50D267FF5BC8 LENGTH: 54 aa
>LEFL2046F14_4_ORF2 Translation of LEFL2046F14 in frame 4, ORF 2, threshold 50, 54aa
YGLSPKKHVIDILDPTLFEIALCSTLKYLSFDKSCRKSPIFTTREPGVGGTSTQ
No hits reported.

SEQUENCE: LEFL2046F14_5_ORF2 CRC64: 057FDC93CCF6D5A4 LENGTH: 52 aa
>LEFL2046F14_5_ORF2 Translation of LEFL2046F14 in frame 5, ORF 2, threshold 50, 52aa
KDRYKTNIGMLNGAHGEFWLRTWWVVVARTEKMKTIHIIFEITTIETETFRQ
noIPR
unintegrated
unintegrated
seg [35-50]? NA seg seg seg

SEQUENCE: LEFL2046F14_5_ORF2 CRC64: 057FDC93CCF6D5A4 LENGTH: 52 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [35-50]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2046F14_5_ORF3 CRC64: 1BF334926A55CFD8 LENGTH: 121 aa
>LEFL2046F14_5_ORF3 Translation of LEFL2046F14 in frame 5, ORF 3, threshold 50, 121aa
TGRIRSHVTENRVSPTCSWNRRFIQIKIASINHFFRSISSVILFLNLVILLKELSCSLQR
SVQDGCWNPMINHLEKTPFLRCISNFVHYLLMLNRILIDTLKVYHWKNEMCFTFFSPVFW
R
No hits reported.

SEQUENCE: LEFL2046F14_6_ORF2 CRC64: 0AFA036273E88D3C LENGTH: 52 aa
>LEFL2046F14_6_ORF2 Translation of LEFL2046F14 in frame 6, ORF 2, threshold 50, 52aa
IPVSSHPWRSLLMTPRMELEILVDWEDSEPCNRKSCLSNLQLEQKIYTNQDC
No hits reported.