LEFL2019P01      To the result of BLAST   To the result of InterProScanTo Home
DDBJ Acc. number
AK327039


>LEFL2019P01
AAAAAAAACTTTCTAGTGTTTTCTTCTTTCTTTTGTTTTTTTTCTCTTTG
CTCATATTCTAAAAATATTTCATCAATGGCATCTATCAAATCAGTAAAAG
TTCCTACTATAGATTTTTCCAATTATCAAGAGCTAAAACCAAACACTCCA
CTATGGGAATCCACAAAAATTCAAGTTTTTGAAGCTTTACAAGAATATGG
TTGTTTTGAAGCAATATATGATAAAGTTTCAAAGGAAATTAGAGAGGAAA
CATTTGATATGTCAAAAGAAATATTTGAATTTCCTTTAGAGACTAAAGTG
AAAAATATCTCAGAAAAACCAATGCATGGCTATATGGGGATGATTCCACA
ATTGCCATTGTATGAGAGTTTGTGTATTCCTGATTTGCTTAATCCTCAAA
GTCTTGAAAAATTTTCTAATATCTTTTGGCCTCAGGGTAATCAACATTTC
TGCAATTTGATAAAATCTTATTCTAATCCACTTGTGGAATTGGATGGGAT
GTTGAAAAGGATGATTTCGGAGAATTTGGGATTGAAAAATCACATTGATG
AATTATTGAATGCCAATTACTTCCTATTTAGATTTACACATTATAAGGGA
TCATCAATTGCTAGTGGAGATGAAAATAATAAAGCTGCTGGATTGGGTGG
CCACACGGATGGTAACTTCTTGACTTTTATATCGCAAAATCAAGTTAATG
GATTGCAAATCAACAAAAATGGAGAATGGATTGATGTGATTATTTCACCA
AATTCTTATGTTGTTTTGGCCGGTGATTCCTTCAAAGCATGGACAAATGG
TCGATTGCATTCACCTCTCCACAGAGTAACAATGTCCGGACAAAATGATA
GACTCTCCATTCAATTGTTTTCATTATCAAAGCCAGGTCACTTCATCCAG
GCACCAAAAGAACTAGTAGATGAAGAACACCCATTACTCTTCAAGCCATT
TGAAATTCTTGAATTATTCAAGTATGGTACCACAGAAGCTGGCTATACAG
CTCCTCCAAGTGATCTTTTCAAGATTTATTGTGGTATTTGATATGCTAAT
TGTTGAATTTCCGCTTCAACAAGCAACTTTTCCAATGAGTTTCATCTTGT
TTTTTTAAGTAGTATGCATTTTATGTTTAAATTGTTGCAGTTGGCAATTC
ATGTTTAATTTGTTTTTGTTTTTTTGAGAAAATATTTCCAATGGGTTTCG
TTGGAAATTCGTCTTGTTTTTTTTTAAGTAGTGTACATCTTATTTTTGGA
CAAAAAAAAAAAAAA


No predicted BACs including this HTC sequence.

KTU3; Kazusa Tomato Unigene ver.3 (KTU3_Contig29037)  (go to MiBASE)
This is a unigene (KTU3) including this clone as an EST member.






Results of BLAST



To the top of page


Database=nr

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2019P01gi|157340298|emb|CAO45975.1|emb|CAO45975.1| unnamed protein product [Vitis vinifera]126531447.83322167476103813143e-83313+1
LEFL2019P01gi|147852209|emb|CAN80138.1|emb|CAN80138.1| hypothetical protein [Vitis vinifera]126531447.83322167476103813148e-83311+1
LEFL2019P01gi|15219099|ref|NP_175691.1|ref|NP_175691.1| 2-oxoglutarate-dependent dioxygenase, putative [Arabidopsis thaliana]///gb|AAG52269.1|AC019018_6 putative oxidoreductase; 38288-39393 [Arabidopsis thaliana]126531744.31325180467103813172e-73280+1
LEFL2019P01gi|15219097|ref|NP_175689.1|ref|NP_175689.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana]///gb|AAG52291.1|AC019018_28 putative oxidoreductase; 33116-34434 [Arabidopsis thaliana]///gb|AAY78650.1| oxidoreductase [Arabidopsis thaliana]126531442.11323185576103813142e-72276+1
LEFL2019P01gi|147852210|emb|CAN80139.1|emb|CAN80139.1| hypothetical protein [Vitis vinifera]126531144.62316173697103873111e-68264+1




To the top of page


Database=UniProt

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2019P01sp|Q96330|FLS1_ARATHsp|Q96330|FLS1_ARATH Flavonol synthase/flavanone 3-hydroxylase OS=Arabidopsis thaliana GN=FLS1 PE=1 SV=1126533626.532942069100951433209e-2098.2+1
LEFL2019P01sp|Q39110|GAOX1_ARATHsp|Q39110|GAOX1_ARATH Gibberellin 20 oxidase 1 OS=Arabidopsis thaliana GN=20ox1 PE=2 SV=2126537725.17290207782921553368e-1995.1+1
LEFL2019P01sp|Q9XHG2|FLS_MALDOsp|Q9XHG2|FLS_MALDO Flavonol synthase/flavanone 3-hydroxylase OS=Malus domestica GN=FLS PE=2 SV=1126533726.17298200788921373124e-1892.8+1
LEFL2019P01sp|O04395|FLS_MATINsp|O04395|FLS_MATIN Flavonol synthase/flavanone 3-hydroxylase (Fragment) OS=Matthiola incana PE=2 SV=1126529125.4428721169794812734e-1789.4+1
LEFL2019P01sp|Q9M547|FLS_EUSGRsp|Q9M547|FLS_EUSGR Flavonol synthase/flavanone 3-hydroxylase OS=Eustoma grandiflorum GN=FLS PE=2 SV=1126533425.9305205994945413177e-1788.6+1




To the top of page


Database=TAIR

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2019P01AT1G52820.1AT1G52820.1 | Symbols: | 2-oxoglutarate-dependent dioxygenase, putative | chr1:19672884-19673989 FORWARD126531744.31325180467103813171e-75280+1
LEFL2019P01AT1G52800.1AT1G52800.1 | Symbols: | oxidoreductase, 2OG-Fe(II) oxygenase family protein | chr1:19667712-19669030 FORWARD126531442.11323185576103813141e-74276+1
LEFL2019P01AT4G03070.1AT4G03070.1 | Symbols: AOP, AOP1.1, AOP1 | AOP1 (2-oxoglutarate?dependent dioxygenase 1.1); oxidoreductase, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors | chr4:1358442-1359620 FORWARD126532243.653071705911002113126e-66248+1
LEFL2019P01AT1G52790.1AT1G52790.1 | Symbols: | oxidoreductase, 2OG-Fe(II) oxygenase family protein | chr1:19665862-19666969 REVERSE126531037.42318196791103523091e-61234+1
LEFL2019P01AT1G28030.1AT1G28030.1 | Symbols: | oxidoreductase, 2OG-Fe(II) oxygenase family protein | chr1:9771780-9773332 FORWARD126532240.0730718086797533037e-56214+1




To the top of page


Database=RAP

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2019P01Os11g0265800|Os11g0265800Os11g0265800|Os11g0265800 2OG-Fe(II) oxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence Os11g0265800126536032.752841768148954383165e-38155+1
LEFL2019P01Os08g0417000|AK068735Os08g0417000|AK068735 2OG-Fe(II) oxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence AK068735126531129.973172188100103833081e-36150+1
LEFL2019P01Os08g0417100|Os08g0417100Os08g0417100|Os08g0417100 2OG-Fe(II) oxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence Os08g0417100126533129.08337218991103823272e-35147+1
LEFL2019P01Os04g0475600|AK121520Os04g0475600|AK121520 2OG-Fe(II) oxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence AK121520126530028.742611835181954262763e-21100+1
LEFL2019P01Os08g0480200|AK065790Os08g0480200|AK065790 2OG-Fe(II) oxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR005123 : 2OG-Fe(II) oxygenase;Representative_sequence AK065790126533730.772341536184858552763e-2096.7+1




To the top of page


Database=SGN Tomato UniGene

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL2019P01SGN-U313227SGN-U313227 Tomato 200607 #1 [231 ESTs aligned] arabidopsis/peptide: AT1G52820.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to AOP1 (Arabidopsis lyrata)(GI:16118889); contains Pfam profile PF03171: 2OG-Fe(II) oxygenase superfamily domain | chr1:19672851-19674095 FORWARD | Aliases: F14G24.9, F14G24_9 (evalue: 3e-75, score=279) genbank/nr: gi|15219099|ref|NP_175691.1| 2-oxoglutarate-dependent dioxygenase, putative [Arabidopsis thaliana] gi|25285705|pir||D96569 probable oxidoreductase, 38288-39393 [imported] - Arabidopsis thaliana gi|12324633|gb|AAG52269.1| putative oxidoreductase; 38288-39393 [Arabidopsis thaliana](evalue: 3e-73, score=279)1265145398.412511623125094134302309Plus
LEFL2019P01SGN-U313226SGN-U313226 Tomato 200607 #1 [37 ESTs aligned] arabidopsis/peptide: AT1G52820.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to AOP1 (Arabidopsis lyrata)(GI:16118889); contains Pfam profile PF03171: 2OG-Fe(II) oxygenase superfamily domain | chr1:19672851-19674095 FORWARD | Aliases: F14G24.9, F14G24_9 (evalue: 7e-53, score=204) genbank/nr: gi|15219099|ref|NP_175691.1| 2-oxoglutarate-dependent dioxygenase, putative [Arabidopsis thaliana] gi|25285705|pir||D96569 probable oxidoreductase, 38288-39393 [imported] - Arabidopsis thaliana gi|12324633|gb|AAG52269.1| putative oxidoreductase; 38288-39393 [Arabidopsis thaliana](evalue: 5e-51, score=204)126598792.768705423141175186901223Plus
LEFL2019P01SGN-U336120SGN-U336120 Tomato 200607 #1 [1 ESTs aligned] arabidopsis/peptide: | Symbol: None | oxidoreductase, 2OG-Fe(II) oxygenase family protein, similar to GS-AOP loci (GI:16118889, GI:16118887, GI:16118891, GI:16118893); contains PF03171 2OG-Fe(II) oxygenase superfamily domain | chr1:19667712-19669030 FORWARD | Aliases: F14G24.7, F14G24_7(evalue: 3e-41, score=165) genbank/nr: gi|15219097|ref|NP_175689.1| oxidoreductase, 2OG-Fe(II) oxygenase family [Arabidopsis thaliana] gi|25285707|pir||B96569 probable oxidoreductase, 33116-34434 [imported] - Arabidopsis thaliana gi|12324655|gb|AAG52291.1| putative oxidoreductase; 33116-34434 [Arabidopsis thaliana](evalue: 2e-39, score=165)126568693.2765440453704196700924Plus
LEFL2019P01SGN-U336122SGN-U336122 Tomato 200607 #1 [1 ESTs aligned] arabidopsis/peptide: AT1G52820.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to AOP1 (Arabidopsis lyrata)(GI:16118889); contains Pfam profile PF03171: 2OG-Fe(II) oxygenase superfamily domain | chr1:19672851-19674095 FORWARD | Aliases: F14G24.9, F14G24_9 (evalue: 2e-17, score=86.3) genbank/nr: gi|15219099|ref|NP_175691.1| 2-oxoglutarate-dependent dioxygenase, putative [Arabidopsis thaliana] gi|25285705|pir||D96569 probable oxidoreductase, 38288-39393 [imported] - Arabidopsis thaliana gi|12324633|gb|AAG52269.1| putative oxidoreductase; 38288-39393 [Arabidopsis thaliana](evalue: 2e-15, score=86.3)126566798.6745131803125014510842Plus
LEFL2019P01SGN-U313203SGN-U313203 Tomato 200607 #1 [11 ESTs aligned] arabidopsis/peptide: AT1G52820.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to AOP1 (Arabidopsis lyrata)(GI:16118889); contains Pfam profile PF03171: 2OG-Fe(II) oxygenase superfamily domain | chr1:19672851-19674095 FORWARD | Aliases: F14G24.9, F14G24_9 (evalue: 8e-19, score=91.7) genbank/nr: gi|15219099|ref|NP_175691.1| 2-oxoglutarate-dependent dioxygenase, putative [Arabidopsis thaliana] gi|25285705|pir||D96569 probable oxidoreductase, 38288-39393 [imported] - Arabidopsis thaliana gi|12324633|gb|AAG52269.1| putative oxidoreductase; 38288-39393 [Arabidopsis thaliana](evalue: 6e-17, score=91.7)1265123599.0341331790120282412350779Plus
LEFL2019P01SGN-U313203SGN-U313203 Tomato 200607 #1 [11 ESTs aligned] arabidopsis/peptide: AT1G52820.1 | Symbol: None | 2-oxoglutarate-dependent dioxygenase, putative, similar to AOP1 (Arabidopsis lyrata)(GI:16118889); contains Pfam profile PF03171: 2OG-Fe(II) oxygenase superfamily domain | chr1:19672851-19674095 FORWARD | Aliases: F14G24.9, F14G24_9 (evalue: 8e-19, score=91.7) genbank/nr: gi|15219099|ref|NP_175691.1| 2-oxoglutarate-dependent dioxygenase, putative [Arabidopsis thaliana] gi|25285705|pir||D96569 probable oxidoreductase, 38288-39393 [imported] - Arabidopsis thaliana gi|12324633|gb|AAG52269.1| putative oxidoreductase; 38288-39393 [Arabidopsis thaliana](evalue: 6e-17, score=91.7)1265123599.393292045978713290636Plus




To the top of page


Database=DFCI Tomato Gene Index

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL2019P01TC201385TC201385 weakly similar to UniRef100_A7P7I9 Cluster: Chromosome chr9 scaffold_7, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr9 scaffold_7, whole genome shotgun sequence - Vitis vinifera (Grape), partial (34%)1265154899.121251723125095134402381Plus
LEFL2019P01TC211696TC211696 weakly similar to UniRef100_A7P7I9 Cluster: Chromosome chr9 scaffold_7, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr9 scaffold_7, whole genome shotgun sequence - Vitis vinifera (Grape), partial (30%)1265158092.1712647283125012126401695Plus
LEFL2019P01TC211696TC211696 weakly similar to UniRef100_A7P7I9 Cluster: Chromosome chr9 scaffold_7, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr9 scaffold_7, whole genome shotgun sequence - Vitis vinifera (Grape), partial (30%)1265158085.076710011071173124013060.00000254Plus
LEFL2019P01TC206091TC206091 weakly similar to UniRef100_A7P7I9 Cluster: Chromosome chr9 scaffold_7, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr9 scaffold_7, whole genome shotgun sequence - Vitis vinifera (Grape), partial (34%)1265160299.07648604521099955160201237Plus
LEFL2019P01TC206091TC206091 weakly similar to UniRef100_A7P7I9 Cluster: Chromosome chr9 scaffold_7, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr9 scaffold_7, whole genome shotgun sequence - Vitis vinifera (Grape), partial (34%)1265160299.74390106345213900765Plus
LEFL2019P01TC208893TC208893 weakly similar to UniRef100_Q2HRI0 Cluster: Immunoglobulin/major histocompatibility complex; 2OG-Fe(II) oxygenase; n=1; Medicago truncatula|Rep: Immunoglobulin/major histocompatibility complex; 2OG-Fe(II) oxygenase - Medicago truncatula (Barrel medic), partial (18%)126575793.32719480757933975701045Plus
LEFL2019P01DB721517DB721517 weakly similar to UniRef100_A7P7J0 Cluster: Chromosome chr9 scaffold_7, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr9 scaffold_7, whole genome shotgun sequence - Vitis vinifera (Grape), partial (13%)126580299.7845001345234510876Plus






Results of InterProScan



To the top of page


SEQUENCE: LEFL2019P01_1_ORF1 CRC64: C2E881E1C9D21707 LENGTH: 346 aa
>LEFL2019P01_1_ORF1 Translation of LEFL2019P01 in frame 1, ORF 1, threshold 50, 346aa
KKNFLVFSSFFCFFSLCSYSKNISSMASIKSVKVPTIDFSNYQELKPNTPLWESTKIQVF
EALQEYGCFEAIYDKVSKEIREETFDMSKEIFEFPLETKVKNISEKPMHGYMGMIPQLPL
YESLCIPDLLNPQSLEKFSNIFWPQGNQHFCNLIKSYSNPLVELDGMLKRMISENLGLKN
HIDELLNANYFLFRFTHYKGSSIASGDENNKAAGLGGHTDGNFLTFISQNQVNGLQINKN
GEWIDVIISPNSYVVLAGDSFKAWTNGRLHSPLHRVTMSGQNDRLSIQLFSLSKPGHFIQ
APKELVDEEHPLLFKPFEILELFKYGTTEAGYTAPPSDLFKIYCGI
InterPro
IPR005123
Domain
2OG-Fe(II) oxygenase
PF03171 [189-293]T 1.7e-23 PF03171 2OG-FeII_Oxy 2OG-FeII_Oxy
noIPR
unintegrated
unintegrated
G3DSA:2.60.120.330 [32-325]T 5.8e-60 G3DSA:2.60.120.330 no description no description
PTHR10209 [49-344]T 1e-104 PTHR10209 IRON/ASCORBATE-DEPENDENT OXIDOREDUCTASE FAMILY MEMBER IRON/ASCORBATE-DEPENDENT OXIDOREDUCTASE FAMILY MEMBER
PTHR10209:SF24 [49-344]T 1e-104 PTHR10209:SF24 2-OXOGLUTARATE-DEPENDENT DIOXYGENASE 2-OXOGLUTARATE-DEPENDENT DIOXYGENASE
seg [4-18]? NA seg seg seg
SSF51197 [29-331]T 1.1e-62 SSF51197 Clavaminate synthase-like Clavaminate synthase-like

SEQUENCE: LEFL2019P01_1_ORF1 CRC64: C2E881E1C9D21707 LENGTH: 346 aa
InterPro
IPR005123
Domain
2OG-Fe(II) oxygenase
PFAMPF031712OG-FeII_Oxy
 1.7e-23 [189-293]T       
Parent no parent
Children IPR006620
Found in IPR002283 IPR004574
Contains IPR002057
GO terms none
noIPR
unintegrated
unintegrated
GENE3DG3DSA:2.60.120.330no description
 5.8e-60 [32-325]T       
PANTHERPTHR10209IRON/ASCORBATE-DEPENDENT OXIDOREDUCTASE FAMILY MEMBER
 1e-104 [49-344]T       
PANTHERPTHR10209:SF242-OXOGLUTARATE-DEPENDENT DIOXYGENASE
 1e-104 [49-344]T       
SEGseg seg
 NA [4-18]?       
SUPERFAMILYSSF51197Clavaminate synthase-like
 1.1e-62 [29-331]T       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2019P01_2_ORF2 CRC64: EF5F72DCDFE88BCF LENGTH: 50 aa
>LEFL2019P01_2_ORF2 Translation of LEFL2019P01 in frame 2, ORF 2, threshold 50, 50aa
NQTLHYGNPQKFKFLKLYKNMVVLKQYMIKFQRKLERKHLICQKKYLNFL
No hits reported.

SEQUENCE: LEFL2019P01_2_ORF3 CRC64: 3B545BCCAF8D11AF LENGTH: 62 aa
>LEFL2019P01_2_ORF3 Translation of LEFL2019P01 in frame 2, ORF 3, threshold 50, 62aa
MKNTHYSSSHLKFLNYSSMVPQKLAIQLLQVIFSRFIVVFDMLIVEFPLQQATFPMSFIL
FF
No hits reported.

SEQUENCE: LEFL2019P01_4_ORF2 CRC64: 982C30CDD5DEC5A5 LENGTH: 80 aa
>LEFL2019P01_4_ORF2 Translation of LEFL2019P01 in frame 4, ORF 2, threshold 50, 80aa
FINVIFQSQILRNHPFQHPIQFHKWIRIRFYQIAEMLITLRPKDIRKFFKTLRIKQIRNT
QTLIQWQLWNHPHIAMHWFF
No hits reported.

SEQUENCE: LEFL2019P01_6_ORF2 CRC64: 6083B8D50E87A8E0 LENGTH: 52 aa
>LEFL2019P01_6_ORF2 Translation of LEFL2019P01 in frame 6, ORF 2, threshold 50, 52aa
PCIGFSEIFFTLVSKGNSNISFDISNVSSLISFETLSYIASKQPYSCKASKT
No hits reported.