LEFL2003DB10      To the result of BLAST   To the result of InterProScanTo Home
DDBJ Acc. number
AK326277


>LEFL2003DB10
GGTCGCCACCTCCAAATCTCTCTCTCTCTGTTTTCTCTCAACAACAACAA
AGAGGTATTTCAATGGCAGTTGAGGCAAGACATCTCAATCTTTTCACTCA
GCAACAGCAGCAAATGGTTTCGAATCAAGGGAATGGGTTTTCGTACAATA
CCCAAATTGTTGGTTCTTCTCTGTTACCGTTACCGACGCCGGAGAATAGT
TTTTTGCCGTTTCATCAGAGTCTGATGTGTGATTCCGTTCAGCCAAAAAC
GTCGGTAAATACGGATAGTGGTCTCACTTTCAATCTTCCTACAACTGTGA
ACGCTACCACTGCTGCCGGTGTAGCGGCGACGAGGAAGCGGTCGAGGGAT
TCGTTTAATCAATTTAATACTTGTAATACTACGTCGTTTGTCGGAGATGA
CGTTTTGCCACTTCTACAACAGTACCAGTGTGATATCGATCGGATTATTT
CGCTTCATACTAAGAAAGTAAGGATGGAATTAGAAGAAAGGCAGAAACAG
CAAGCGAGGGTGTTGGTTGCAGCAATCGGGGAAGGCGTATCGAAAAAACT
GAAAGAGAAAGACGAACAAATTCAACGAATGGGGAAAATCAATATGGTTC
TACAAGAAAAAGTGAAAAGTCTGTTCGTTGAGAATCAGTTATGGAGAGAT
TTAGCACAAACAAACGAAGCAACAGCGAATTCCCTCCGCAACAACTTAGA
ACAAGTATTAGCCCACGTCGGGGACGAACGTATCTCCGCCGGCGGTAACT
TCGCCGGAACCGCAGTTGAGGAAGTCGCCGAATCCTGCTGCGGCAGCAGC
GACCACGGGGCGGGGGCGGAAGAGGAGGATGAAATCGAAGGCCGGCGCAC
CATAGTCGGAGAAGCGCAGGATAACAGGATGTGCAAAAGGTGTGGTGAGA
GGGAATCATGTGTATTGCTATTGCCATGCAGGCATCTTTGCCTGTGTGCT
GTTTGTGGTTCAAGTTTAGTCCATACATGCCCTGTATGCAACTCTAACAT
GAATGCCACTGTGCATGTTAACATGTCTTCTTGATCCATCAATCAAAATC
CCAAAAAAAAAAAAAAA


No predicted BACs including this HTC sequence.

KTU3; Kazusa Tomato Unigene ver.3 (KTU3_Contig26320)  (go to MiBASE)
This is a unigene (KTU3) including this clone as an EST member.






Results of BLAST



To the top of page


Database=nr

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2003DB10gi|118486096|gb|ABK94891.1|gb|ABK94891.1| unknown [Populus trichocarpa]///gb|ABK95054.1| unknown [Populus trichocarpa]106733451.16346145663102813342e-83313+3
LEFL2003DB10gi|147852711|emb|CAN83796.1|emb|CAN83796.1| hypothetical protein [Vitis vinifera]///emb|CAO44432.1| unnamed protein product [Vitis vinifera]106730352.76326150863102813034e-82308+3
LEFL2003DB10gi|118488869|gb|ABK96244.1|gb|ABK96244.1| unknown [Populus trichocarpa x Populus deltoides]106734045.89353160963102813401e-73280+3
LEFL2003DB10gi|157348810|emb|CAO23811.1|emb|CAO23811.1| unnamed protein product [Vitis vinifera]106726247.692811416204102822629e-63244+3
LEFL2003DB10gi|110739742|dbj|BAF01778.1|dbj|BAF01778.1| hypothetical protein [Arabidopsis thaliana]///dbj|BAF01934.1| hypothetical protein [Arabidopsis thaliana]106735544.053701601463103113552e-62243+3




To the top of page


Database=UniProt

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2003DB10sp|O08863|BIRC3_MOUSEsp|O08863|BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus GN=Birc3 PE=1 SV=1106760040.745432186710285486000.00000452.4+3
LEFL2003DB10sp|Q9BY78|RNF26_HUMANsp|Q9BY78|RNF26_HUMAN RING finger protein 26 OS=Homo sapiens GN=RNF26 PE=2 SV=1106743331.589556276210193374310.0000151.2+3
LEFL2003DB10sp|P41437|IAP3_NPVOPsp|P41437|IAP3_NPVOP Apoptosis inhibitor 3 OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=IAP3 PE=1 SV=1106726834.128556376510191872650.0000151.2+3
LEFL2003DB10sp|Q62210|BIRC2_MOUSEsp|Q62210|BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus GN=Birc2 PE=1 SV=1106761224.31144109459710284896120.0000151.2+3




To the top of page


Database=TAIR

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2003DB10AT1G79110.2AT1G79110.2 | Symbols: | protein binding / zinc ion binding | chr1:29764238-29765479 FORWARD106735544.053701601463103113551e-64243+3
LEFL2003DB10AT3G12920.1AT3G12920.1 | Symbols: | protein binding / zinc ion binding | chr3:4122134-4123330 REVERSE106733543.023511721163103113352e-64243+3
LEFL2003DB10AT1G79110.1AT1G79110.1 | Symbols: | protein binding / zinc ion binding | chr1:29764238-29765479 FORWARD106735843.73731601563103113585e-63238+3
LEFL2003DB10AT5G45100.1AT5G45100.1 | Symbols: | protein binding / zinc ion binding | chr5:18235996-18236968 FORWARD106729443.953391741163103112945e-58221+3
LEFL2003DB10AT4G19700.1AT4G19700.1 | Symbols: | protein binding / zinc ion binding | chr4:10713643-10714645 REVERSE106730441.473401821263103113041e-56216+3




To the top of page


Database=RAP

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL2003DB10Os04g0403200|AK120702Os04g0403200|AK120702 Zinc finger, RING-type domain containing protein.;category III : InterPro domain-containing protein;GO_id GO:0005515 : protein binding;GO_id GO:0008270 : zinc ion binding;InterPro_id IPR001841 : Zinc finger, RING-type;Representative_sequence AK120702106734732.23211141340210281443476e-27118+3
LEFL2003DB10Os04g0402500|Os04g0402500Os04g0402500|Os04g0402500 Zinc finger, RING-type domain containing protein.;category III : InterPro domain-containing protein;GO_id GO:0005515 : protein binding;GO_id GO:0008270 : zinc ion binding;InterPro_id IPR001841 : Zinc finger, RING-type;Representative_sequence Os04g0402500106731631.93238162531510281033163e-26116+3
LEFL2003DB10Os02g0524500|Os02g0524500Os02g0524500|Os02g0524500 Zinc finger, RING-type domain containing protein.;category III : InterPro domain-containing protein;GO_id GO:0005515 : protein binding;GO_id GO:0008270 : zinc ion binding;InterPro_id IPR001841 : Zinc finger, RING-type;Representative_sequence Os02g0524500106745732.84204136441110192644547e-26115+3
LEFL2003DB10Os03g0263800|AK061795Os03g0263800|AK061795 Zinc finger, RING-type domain containing protein.;category III : InterPro domain-containing protein;GO_id GO:0005515 : protein binding;GO_id GO:0008270 : zinc ion binding;InterPro_id IPR001841 : Zinc finger, RING-type;Representative_sequence AK061795106734230.3520114033969981463332e-25114+3
LEFL2003DB10Os11g0542100|J065162B12Os11g0542100|J065162B12 Zinc finger, RING-type domain containing protein.;category III : InterPro domain-containing protein;GO_id GO:0005515 : protein binding;GO_id GO:0008270 : zinc ion binding;InterPro_id IPR001841 : Zinc finger, RING-type;Representative_sequence J065162B12106732732.4619112444329891283113e-22103+3




To the top of page


Database=SGN Tomato UniGene

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL2003DB10SGN-U325607SGN-U325607 Tomato 200607 #1 [5 ESTs aligned] arabidopsis/peptide: | Symbol: None | expressed protein | chr3:4121890-4123503 REVERSE | Aliases: MGH6.3(evalue: 9e-34, score=140) genbank/nr: Zinc(evalue: 2e-36, score=154)106768499.276845014697168401316Plus
LEFL2003DB10SGN-U323178SGN-U323178 Tomato 200607 #1 [7 ESTs aligned] arabidopsis/peptide: | Symbol: None | expressed protein | chr1:29764079-29765597 FORWARD | Aliases: None(evalue: 5e-36, score=147) genbank/nr: gi|18412263|ref|NP_565200.1| expressed protein [Arabidopsis thaliana](evalue: 3e-34, score=147)106774098.6644942620106714480827Plus
LEFL2003DB10SGN-U318850SGN-U318850 Tomato 200607 #1 [14 ESTs aligned] arabidopsis/peptide: | Symbol: None | expressed protein | chr3:4121890-4123503 REVERSE | Aliases: MGH6.3(evalue: 4e-50, score=196) genbank/nr: gi|18399792|ref|NP_566438.1| expressed protein [Arabidopsis thaliana] gi|15795121|dbj|BAB02499.1| gene_id:MGH6.3~unknown protein [Arabidopsis thaliana] gi|26451940|dbj|BAC43062.1| unknown protein [Arabidopsis thaliana] gi|30017303|gb|AAP12885.1| At3g12920 [Arabidopsis thaliana](evalue: 3e-48, score=196)1067147878.753206803847033336525e-1995.6Plus
LEFL2003DB10SGN-U318850SGN-U318850 Tomato 200607 #1 [14 ESTs aligned] arabidopsis/peptide: | Symbol: None | expressed protein | chr3:4121890-4123503 REVERSE | Aliases: MGH6.3(evalue: 4e-50, score=196) genbank/nr: gi|18399792|ref|NP_566438.1| expressed protein [Arabidopsis thaliana] gi|15795121|dbj|BAB02499.1| gene_id:MGH6.3~unknown protein [Arabidopsis thaliana] gi|26451940|dbj|BAC43062.1| unknown protein [Arabidopsis thaliana] gi|30017303|gb|AAP12885.1| At3g12920 [Arabidopsis thaliana](evalue: 3e-48, score=196)1067147888.1459708739318318890.00000000761.9Plus




To the top of page


Database=DFCI Tomato Gene Index

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL2003DB10TC211502TC211502 weakly similar to UniRef100_UPI000034F565 Cluster: protein binding / zinc ion binding; n=1; Arabidopsis thaliana|Rep: protein binding / zinc ion binding - Arabidopsis thaliana, partial (45%)1067118499.811046202210671104602058Plus
LEFL2003DB10TC201304TC201304 weakly similar to UniRef100_A7PWS0 Cluster: Chromosome chr19 scaffold_35, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr19 scaffold_35, whole genome shotgun sequence - Vitis vinifera (Grape), partial (41%)106770598.1570312122723170301283Plus
LEFL2003DB10TC202502TC202502 weakly similar to UniRef100_Q9FHE4 Cluster: Genomic DNA, chromosome 5, TAC clone:K17O22; n=2; Arabidopsis thaliana|Rep: Genomic DNA, chromosome 5, TAC clone:K17O22 - Arabidopsis thaliana (Mouse-ear cress), partial (38%)1067108179.063206703847032876062e-21103Plus
LEFL2003DB10TC202502TC202502 weakly similar to UniRef100_Q9FHE4 Cluster: Genomic DNA, chromosome 5, TAC clone:K17O22; n=2; Arabidopsis thaliana|Rep: Genomic DNA, chromosome 5, TAC clone:K17O22 - Arabidopsis thaliana (Mouse-ear cress), partial (38%)1067108192.6841308739137888280.000000158Plus
LEFL2003DB10TC197182TC197182 weakly similar to UniRef100_Q9FHE4 Cluster: Genomic DNA, chromosome 5, TAC clone:K17O22; n=2; Arabidopsis thaliana|Rep: Genomic DNA, chromosome 5, TAC clone:K17O22 - Arabidopsis thaliana (Mouse-ear cress), partial (32%)106769378.443206903847033386574e-1789.7Plus






Results of InterProScan



To the top of page


SEQUENCE: LEFL2003DB10_1_ORF1 CRC64: 257BDB6C7D6157BB LENGTH: 74 aa
>LEFL2003DB10_1_ORF1 Translation of LEFL2003DB10 in frame 1, ORF 1, threshold 50, 74aa
GRHLQISLSLFSLNNNKEVFQWQLRQDISIFSLSNSSKWFRIKGMGFRTIPKLLVLLCYR
YRRRRIVFCRFIRV
noIPR
unintegrated
unintegrated
seg [53-73]? NA seg seg seg

SEQUENCE: LEFL2003DB10_1_ORF1 CRC64: 257BDB6C7D6157BB LENGTH: 74 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [53-73]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2003DB10_2_ORF2 CRC64: D9DE4CC1E0C37854 LENGTH: 55 aa
>LEFL2003DB10_2_ORF2 Translation of LEFL2003DB10 in frame 2, ORF 2, threshold 50, 55aa
ESKDGIRRKAETASEGVGCSNRGRRIEKTERERRTNSTNGENQYGSTRKSEKSVR
noIPR
unintegrated
unintegrated
seg [22-34]? NA seg seg seg

SEQUENCE: LEFL2003DB10_2_ORF2 CRC64: D9DE4CC1E0C37854 LENGTH: 55 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [22-34]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2003DB10_3_ORF1 CRC64: 9F5E6F1526604956 LENGTH: 343 aa
>LEFL2003DB10_3_ORF1 Translation of LEFL2003DB10 in frame 3, ORF 1, threshold 50, 343aa
SPPPNLSLSVFSQQQQRGISMAVEARHLNLFTQQQQQMVSNQGNGFSYNTQIVGSSLLPL
PTPENSFLPFHQSLMCDSVQPKTSVNTDSGLTFNLPTTVNATTAAGVAATRKRSRDSFNQ
FNTCNTTSFVGDDVLPLLQQYQCDIDRIISLHTKKVRMELEERQKQQARVLVAAIGEGVS
KKLKEKDEQIQRMGKINMVLQEKVKSLFVENQLWRDLAQTNEATANSLRNNLEQVLAHVG
DERISAGGNFAGTAVEEVAESCCGSSDHGAGAEEEDEIEGRRTIVGEAQDNRMCKRCGER
ESCVLLLPCRHLCLCAVCGSSLVHTCPVCNSNMNATVHVNMSS
InterPro
IPR001841
Domain
Zinc finger, RING-type
PS50089 [294-330]T 8.963 PS50089 ZF_RING_2 ZF_RING_2
noIPR
unintegrated
unintegrated
PTHR10044 [289-342]T 1.6e-07 PTHR10044 INHIBITOR OF APOPTOSIS INHIBITOR OF APOPTOSIS
PTHR10044:SF9 [289-342]T 1.6e-07 PTHR10044:SF9 INHIBITOR OF APOPTOSIS PROTEIN 1 AND 2, IAP1, IAP2 INHIBITOR OF APOPTOSIS PROTEIN 1 AND 2, IAP1, IAP2
seg [33-37]? NA seg seg[97-110]? NA seg seg[269-280]? NA seg seg seg
SSF57850 [286-342]T 1.1e-07 SSF57850 RING/U-box RING/U-box

SEQUENCE: LEFL2003DB10_3_ORF1 CRC64: 9F5E6F1526604956 LENGTH: 343 aa
InterPro
IPR001841
Domain
Zinc finger, RING-type
PROFILEPS50089ZF_RING_2
 8.963 [294-330]T       
Parent no parent
Children no children
Found in IPR001237 IPR004575 IPR004580 IPR007954 IPR011364 IPR012227 IPR013083 IPR015458 IPR015459 IPR016390 IPR016398 IPR016495 IPR016528 IPR016569 IPR016818 IPR016902 IPR017066 IPR017335 IPR017375
Contains no entries
GO terms Molecular Function: protein binding (GO:0005515)
Molecular Function: zinc ion binding (GO:0008270)
noIPR
unintegrated
unintegrated
PANTHERPTHR10044INHIBITOR OF APOPTOSIS
 1.6e-07 [289-342]T       
PANTHERPTHR10044:SF9INHIBITOR OF APOPTOSIS PROTEIN 1 AND 2, IAP1, IAP2
 1.6e-07 [289-342]T       
SEGseg seg
 NA [33-37]?   NA [97-110]?   NA [269-280]?   
SUPERFAMILYSSF57850RING/U-box
 1.1e-07 [286-342]T       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2003DB10_4_ORF2 CRC64: 0CAC21B5284A45E9 LENGTH: 134 aa
>LEFL2003DB10_4_ORF2 Translation of LEFL2003DB10 in frame 4, ORF 2, threshold 50, 134aa
SCIQGMYGLNLNHKQHTGKDACMAIAIHMIPSHHTFCTSCYPALLRLWCAGLRFHPPLPP
PPRGRCCRSRIRRLPQLRFRRSYRRRRYVRPRRGLILVLSCCGGNSLLLRLFVLNLSITD
SQRTDFSLFLVEPY
noIPR
unintegrated
unintegrated
seg [52-93]? NA seg seg[107-116]? NA seg seg seg

SEQUENCE: LEFL2003DB10_4_ORF2 CRC64: 0CAC21B5284A45E9 LENGTH: 134 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [52-93]?   NA [107-116]?     
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2003DB10_4_ORF3 CRC64: D549DEB6C976ED9C LENGTH: 59 aa
>LEFL2003DB10_4_ORF3 Translation of LEFL2003DB10 in frame 4, ORF 3, threshold 50, 59aa
DHYPYLPTFLAERNHTSDSDETAKNYSPASVTVTEKNQQFGYCTKTHSLDSKPFAAVAE
No hits reported.

SEQUENCE: LEFL2003DB10_5_ORF2 CRC64: E64CFE87EAF4E6DF LENGTH: 135 aa
>LEFL2003DB10_5_ORF2 Translation of LEFL2003DB10 in frame 5, ORF 2, threshold 50, 135aa
LMDQEDMLTCTVAFMLELHTGHVWTKLEPQTAHRQRCLHGNSNTHDSLSPHLLHILLSCA
SPTMVRRPSISSSSSAPAPWSLLPQQDSATSSTAVPAKLPPAEIRSSPTWANTCSKLLRR
EFAVASFVCAKSLHN
noIPR
unintegrated
unintegrated
seg [45-58]? NA seg seg[68-84]? NA seg seg seg

SEQUENCE: LEFL2003DB10_5_ORF2 CRC64: E64CFE87EAF4E6DF LENGTH: 135 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [45-58]?   NA [68-84]?     
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2003DB10_6_ORF2 CRC64: 12018B386E19DFE9 LENGTH: 65 aa
>LEFL2003DB10_6_ORF2 Translation of LEFL2003DB10 in frame 6, ORF 2, threshold 50, 65aa
FPLTTPFAHPVILRFSDYGAPAFDFILLFRPRPVVAAAAAGFGDFLNCGSGEVTAGGDTF
VPDVG
noIPR
unintegrated
unintegrated
seg [29-43]? NA seg seg seg

SEQUENCE: LEFL2003DB10_6_ORF2 CRC64: 12018B386E19DFE9 LENGTH: 65 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [29-43]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL2003DB10_6_ORF3 CRC64: CF60101E9886CC1A LENGTH: 77 aa
>LEFL2003DB10_6_ORF3 Translation of LEFL2003DB10 in frame 6, ORF 3, threshold 50, 77aa
KWQNVISDKRRSITSIKLIKRIPRPLPRRRYTGSSGSVHSCRKIESETTIRIYRRFWLNG
ITHQTLMKRQKTILRRR
noIPR
unintegrated
unintegrated
seg [16-30]? NA seg seg seg

SEQUENCE: LEFL2003DB10_6_ORF3 CRC64: CF60101E9886CC1A LENGTH: 77 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [16-30]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none