LEFL1034BD04      To the result of BLAST   To the result of InterProScanTo Home
DDBJ Acc. number
AK322165


>LEFL1034BD04
CTACTTGAATTCTCTTAAACAGAAACAAGAACAAAAATGGCAGCTCAAGG
AACTTGCCTTAATCACGTCTCCAGAGAATCCTCTGATATCAAACGCCTAG
CCCAATTTTACATTGAGATATTTGGGTTTCAGAAAGTTGAAGCTCCAAGA
TTTGAATTTGATGTGATATGGTTGAAGCTGGCACCGTCCTTTTATCTTCA
CCTTATCGAGAGAGACCCGACTACGAAGCTTCCAGAAGGTCCATGGAGTG
CCACGTCAGCCATCGCTGACCCGAAGAATCTGCCCAGAGGTCACCATGTC
TGCTTCACCATCTCCAATTTCGATTCCTTTGTTCAGAAGCTCAAGGATAA
AGGAATTGAAGTTCATGAGAGGACTCAACCAGATGGCAAGACCAAACAAG
CCTTTTTCTTTGATCCAGATGGAAATGGTTTGGAGGTAAGCAGTGGGGCT
CCTGCCTCCTAGACAGTGACCAAACTGTTGGTGTTCCGTTTAAGTTTTAG
AGTATAATAAACCCACAGGACTCGAAAAACATTAGCTCAGATGATGATGA
CCTTGTGTAAATTTTCGTATTGGTATGAAAATATTGTGTCGTTTAGTTAT
GCTTTTTCCTTGCAATTGCCTCCGAGAAACTTGTACCCTGATTGTTATCG
ATACTCCCTCCGTCCGGTACTGTTTGTCATGGTTTCTATTTTTTGAGTCA
AATTATAAAAACTTTGAGTAATATTTTAAGATGAAAAAAAAAAAAAAA


No predicted BACs including this HTC sequence.

KTU3; Kazusa Tomato Unigene ver.3 (KTU3_Contig22728)  (go to MiBASE)
This is a unigene (KTU3) including this clone as an EST member.






Results of BLAST



To the top of page


Database=nr

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1034BD04gi|147782865|emb|CAN67865.1|emb|CAN67865.1| hypothetical protein [Vitis vinifera]74814364.031395004045631414e-51204+1
LEFL1034BD04gi|18402873|ref|NP_565737.1|ref|NP_565737.1| lactoylglutathione lyase family protein / glyoxalase I family protein [Arabidopsis thaliana]///gb|AAL24279.1| At2g32090/F22D22.16 [Arabidopsis thaliana]///gb|AAL79592.1| At2g32090/F22D22.16 [Arabidopsis thaliana]///gb|AAD15395.2| expressed protein [Arabidopsis thaliana]74813561.541304915844441331e-44183+1
LEFL1034BD04gi|21593078|gb|AAM65027.1|gb|AAM65027.1| unknown [Arabidopsis thaliana]74813561.541304915844441331e-44183+1
LEFL1034BD04gi|157336495|emb|CAO71180.1|emb|CAO71180.1| unnamed protein product [Vitis vinifera]74813160.81254904041431273e-43178+1
LEFL1034BD04gi|42571011|ref|NP_973579.1|ref|NP_973579.1| lactoylglutathione lyase family protein / glyoxalase I family protein [Arabidopsis thaliana]74811359.0911044111844421117e-36154+1




To the top of page


Database=UniProt

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1034BD04sp|Q09751|LGUL_SCHPOsp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe GN=glo1 PE=1 SV=174830230.8214684858444121520.00000352.4+1




To the top of page


Database=TAIR

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1034BD04AT2G32090.1AT2G32090.1 | Symbols: | lactoylglutathione lyase family protein / glyoxalase I family protein | chr2:13651577-13652685 FORWARD74813561.541304915844441338e-47183+1
LEFL1034BD04AT2G32090.2AT2G32090.2 | Symbols: | lactoylglutathione lyase family protein / glyoxalase I family protein | chr2:13651797-13652685 FORWARD74811359.0911044111844421115e-38154+1
LEFL1034BD04AT2G28420.1AT2G28420.1 | Symbols: | lactoylglutathione lyase family protein / glyoxalase I family protein | chr2:12165023-12165577 FORWARD74818431.8213285558438211410.0000000000166.6+1
LEFL1034BD04AT1G80160.1AT1G80160.1 | Symbols: | lactoylglutathione lyase family protein / glyoxalase I family protein | chr1:30155993-30156822 FORWARD74816726.1513093458438141320.00000150.1+1
LEFL1034BD04AT1G15380.2AT1G15380.2 | Symbols: | lactoylglutathione lyase family protein / glyoxalase I family protein | chr1:5290950-5292282 FORWARD74817428.0313292552438121320.00000747.8+1




To the top of page


Database=RAP

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1034BD04Os03g0659300|J065130F16Os03g0659300|J065130F16 Glyoxalase/bleomycin resistance protein/dioxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR011588 : Glyoxalase/extradiol ring-cleavage dioxygenase;InterPro_id IPR004360 : Glyoxalase/bleomycin resistance protein/dioxygenase;Representative_sequence J065130F16748141501326335844461352e-32135+1
LEFL1034BD04Os07g0657100|AK108253Os07g0657100|AK108253 Glyoxalase/extradiol ring-cleavage dioxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR011588 : Glyoxalase/extradiol ring-cleavage dioxygenase;InterPro_id IPR004360 : Glyoxalase/bleomycin resistance protein/dioxygenase;Representative_sequence AK10825374820928.7913289558438501710.0000000157+1
LEFL1034BD04Os04g0538900|Os04g0538900Os04g0538900|Os04g0538900 Glyoxalase/bleomycin resistance protein/dioxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR011588 : Glyoxalase/extradiol ring-cleavage dioxygenase;InterPro_id IPR004360 : Glyoxalase/bleomycin resistance protein/dioxygenase;Representative_sequence Os04g053890074817530.8313386558438191420.0000000355.8+1
LEFL1034BD04Os01g0173600|Os01g0173600Os01g0173600|Os01g0173600 Glyoxalase/bleomycin resistance protein/dioxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR011588 : Glyoxalase/extradiol ring-cleavage dioxygenase;InterPro_id IPR004360 : Glyoxalase/bleomycin resistance protein/dioxygenase;Representative_sequence Os01g017360074821527.6913091458438221400.0000000455.5+1
LEFL1034BD04Os05g0171900|AK069814Os05g0171900|AK069814 Glyoxalase/bleomycin resistance protein/dioxygenase domain containing protein.;category III : InterPro domain-containing protein;GO_id No significant hit available;InterPro_id IPR011588 : Glyoxalase/extradiol ring-cleavage dioxygenase;InterPro_id IPR004360 : Glyoxalase/bleomycin resistance protein/dioxygenase;Representative_sequence AK06981474820827.6913091458438231410.000000352.4+1




To the top of page


Database=SGN Tomato UniGene

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL1034BD04SGN-U320961SGN-U320961 Tomato 200607 #1 [9 ESTs aligned] arabidopsis/peptide: | Symbol: None | lactoylglutathione lyase family protein / glyoxalase I family protein, contains glyoxalase family protein domain, Pfam:PF00903 | chr2:13651472-13652874 FORWARD | Aliases: F22D22.16, F22D22_16(evalue: 3e-46, score=181) genbank/nr: Glyoxalase/bleomycin(evalue: 3e-49, score=197)74877196.2371619423735271201181Plus
LEFL1034BD04SGN-U337254SGN-U337254 Tomato 200607 #1 [1 ESTs aligned] arabidopsis/peptide: | Symbol: None | lactoylglutathione lyase family protein / glyoxalase I family protein, contains glyoxalase family protein domain, Pfam:PF00903 | chr2:13651472-13652874 FORWARD | Aliases: F22D22.16, F22D22_16(evalue: 4e-41, score=164) genbank/nr: Glyoxalase/bleomycin(evalue: 3e-44, score=181)74832397.12312903935083193e-155547Plus
LEFL1034BD04SGN-U318103SGN-U318103 Tomato 200607 #1 [2 ESTs aligned] genbank/nr: gi|3171251|gb|AAC78470.1| germin-like protein [Solanum tuberosum] (evalue: 7e-14, score=80.5)74878488.4169806617296997670.00000000000173.8Plus
LEFL1034BD04SGN-U345363SGN-U345363 Tomato 200607 #1 [1 ESTs aligned]74858987.363806717332292910.00000000561.9Plus
LEFL1034BD04SGN-U324675SGN-U324675 Tomato 200607 #1 [5 ESTs aligned]748101690.9144406747179109530.000000356Plus




To the top of page


Database=DFCI Tomato Gene Index

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL1034BD04TC195653TC195653 weakly similar to UniRef100_Q9SKZ0 Cluster: Expressed protein; n=1; Arabidopsis thaliana|Rep: Expressed protein - Arabidopsis thaliana (Mouse-ear cress), partial (93%)74878199.05738411735173801403Plus
LEFL1034BD04AI780112AI780112 weakly similar to UniRef100_Q9SKZ0 Cluster: Expressed protein; n=1; Arabidopsis thaliana|Rep: Expressed protein - Arabidopsis thaliana (Mouse-ear cress), partial (88%)74847297.66385903842273910692Plus
LEFL1034BD04BW686969BW68696974852387.363806717331882500.00000000661.9Plus
LEFL1034BD04TC205780TC2057807485749050416837324545020.00000552Plus






Results of InterProScan



To the top of page


SEQUENCE: LEFL1034BD04_1_ORF2 CRC64: 67F7D41C0EBB64DA LENGTH: 147 aa
>LEFL1034BD04_1_ORF2 Translation of LEFL1034BD04 in frame 1, ORF 2, threshold 50, 147aa
TETRTKMAAQGTCLNHVSRESSDIKRLAQFYIEIFGFQKVEAPRFEFDVIWLKLAPSFYL
HLIERDPTTKLPEGPWSATSAIADPKNLPRGHHVCFTISNFDSFVQKLKDKGIEVHERTQ
PDGKTKQAFFFDPDGNGLEVSSGAPAS
InterPro
IPR004360
Domain
Glyoxalase/bleomycin resistance protein/dioxygenase
PF00903 [13-140]T 4.5e-09 PF00903 Glyoxalase Glyoxalase
InterPro
IPR011588
Domain
Glyoxalase/extradiol ring-cleavage dioxygenase
PD002334 [14-139]T 2e-45 PD002334 Q9SKZ0_ARATH_Q9SKZ0; Q9SKZ0_ARATH_Q9SKZ0;
noIPR
unintegrated
unintegrated
G3DSA:3.10.180.10 [14-140]T 2.5e-13 G3DSA:3.10.180.10 no description no description
PTHR10374 [7-142]T 2e-23 PTHR10374 LACTOYLGLUTATHIONE LYASE (GLYOXALASE I) LACTOYLGLUTATHIONE LYASE (GLYOXALASE I)
SSF54593 [7-142]T 4.9e-20 SSF54593 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase

SEQUENCE: LEFL1034BD04_1_ORF2 CRC64: 67F7D41C0EBB64DA LENGTH: 147 aa
InterPro
IPR004360
Domain
Glyoxalase/bleomycin resistance protein/dioxygenase
PFAMPF00903Glyoxalase
 4.5e-09 [13-140]T       
Parent no parent
Children IPR011588
Found in IPR000335 IPR004361 IPR005956 IPR017515
Contains IPR000486
GO terms none
InterPro
IPR011588
Domain
Glyoxalase/extradiol ring-cleavage dioxygenase
PRODOMPD002334Q9SKZ0_ARATH_Q9SKZ0;
 2e-45 [14-139]T       
Parent IPR004360
Children no children
Found in IPR004361 IPR011981 IPR017624 IPR017626
Contains no entries
GO terms none
noIPR
unintegrated
unintegrated
GENE3DG3DSA:3.10.180.10no description
 2.5e-13 [14-140]T       
PANTHERPTHR10374LACTOYLGLUTATHIONE LYASE (GLYOXALASE I)
 2e-23 [7-142]T       
SUPERFAMILYSSF54593Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
 4.9e-20 [7-142]T       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL1034BD04_1_ORF3 CRC64: 28DED1A59624868B LENGTH: 61 aa
>LEFL1034BD04_1_ORF3 Translation of LEFL1034BD04 in frame 1, ORF 3, threshold 50, 61aa
THRTRKTLAQMMMTLCKFSYWYENIVSFSYAFSLQLPPRNLYPDCYRYSLRPVLFVMVSI
F
No hits reported.

SEQUENCE: LEFL1034BD04_2_ORF2 CRC64: 28B4C8E24FB2ECC8 LENGTH: 87 aa
>LEFL1034BD04_2_ORF2 Translation of LEFL1034BD04 in frame 2, ORF 2, threshold 50, 87aa
SWHRPFIFTLSRETRLRSFQKVHGVPRQPSLTRRICPEVTMSASPSPISIPLFRSSRIKE
LKFMRGLNQMARPNKPFSLIQMEMVWR
No hits reported.

SEQUENCE: LEFL1034BD04_2_ORF3 CRC64: 47926AF5D079FFDD LENGTH: 56 aa
>LEFL1034BD04_2_ORF3 Translation of LEFL1034BD04 in frame 2, ORF 3, threshold 50, 56aa
PCVNFRIGMKILCRLVMLFPCNCLRETCTLIVIDTPSVRYCLSWFLFFESNYKNFE
No hits reported.

SEQUENCE: LEFL1034BD04_4_ORF2 CRC64: E76C110BFA9804B7 LENGTH: 56 aa
>LEFL1034BD04_4_ORF2 Translation of LEFL1034BD04 in frame 4, ORF 2, threshold 50, 56aa
FDSKNRNHDKQYRTEGVSITIRVQVSRRQLQGKSITKRHNIFIPIRKFTQGHHHLS
No hits reported.

SEQUENCE: LEFL1034BD04_4_ORF3 CRC64: 63CE24A6BB1E7F9F LENGTH: 77 aa
>LEFL1034BD04_4_ORF3 Translation of LEFL1034BD04 in frame 4, ORF 3, threshold 50, 77aa
TEHQQFGHCLGGRSPTAYLQTISIWIKEKGLFGLAIWLSPLMNFNSFILELLNKGIEIGD
GEADMVTSGQILRVSDG
No hits reported.

SEQUENCE: LEFL1034BD04_4_ORF4 CRC64: 55A897CD612CEC10 LENGTH: 52 aa
>LEFL1034BD04_4_ORF4 Translation of LEFL1034BD04 in frame 4, ORF 4, threshold 50, 52aa
RGTPWTFWKLRSRVSLDKVKIKGRCQLQPYHIKFKSWSFNFLKPKYLNVKLG
No hits reported.

SEQUENCE: LEFL1034BD04_5_ORF2 CRC64: 6E5760E48DFEB837 LENGTH: 51 aa
>LEFL1034BD04_5_ORF2 Translation of LEFL1034BD04 in frame 5, ORF 2, threshold 50, 51aa
NLNGTPTVWSLSRRQEPHCLPPNHFHLDQRKRLVWSCHLVESSHELQFLYP
No hits reported.