LEFL1025BA08      To the result of BLAST   To the result of InterProScanTo Home
DDBJ Acc. number
AK321479


>LEFL1025BA08
ATCAATTTAGGGAAAAGAAGAGGTAGCACACAAAAATGGACCTCTTCCTC
CTCTCTTTTGCAACCACACTTACTATAATCATCTATTCTTTGTTCAAATA
TTTCTTTGCCAAGCCTAAAGAAAAAATGCCTCTAGCTCCAGGCACCTTTG
GTTGGCCTATTATTGGAGAAACCATCCAATTCCTTTTTTCACTTTACTAT
GGATTGGTCCATGAGTTTGTTCAAGAAAGAACCAAAAAATACAACTCTCA
TGTATTCAAAACCTCATTACTTGGCCAAAAAGTTGTTGTTTTTTCAGGTC
CAGCAGCTAACAAATTCATATTCACTCAAGGTAATAAGCTTATCATTGGT
TGGAGACCTAAGTCTGTTCAAAAGCTCTTCCCATCAACATCATTTGTCCC
TATTGAACATGACACTAAAAGGGCACATAATGTCATTAGCTATTTTTTGA
ACTCACAAAATGTTGAGAGACTTATAAGTACTATGGAGAATATGTCACAT
TTACACTTGAAAAATCATTGGAAAGGGAAAAATGAAGTGATGGTATATGA
TCAAGTGAAGTTATTCACTTTCTCCCTTTCTATTAGAGCCTTTATGGGGA
TCGAGGATTCGGATAAAATCTTGAATCTTTATGAAAAATTCAAGATTTTT
ACACAAGGTCTTTTGGCAGTGGACATAAATCTTCCTGGCACAACATTTTA
TAAGGCAATGAAAGCTGGGAATGAATTAAGGAAACAAATGAAGGTTATTA
TTAAACAAAGAAGGGTAGAATTATTTGAAAATCCAAATTTGTCAAAAGTT
GATGTGTTGACACAAATGATCAATGAACAAGATGAAGATGGAAAGTACAT
GACTGAAGTTGAAATAGAGGATAAAGTGTTTGGCTTCATTATTGGTAGTT
ATGATACTACTGCTACAACTATTACTTTGACCATGAAGTACCTTCAACAA
ATGCCTGAGTTCTTCAATGAAATAATTCAAGAGCAAAATGAGATATCAAG
GCAAATGATGCCAAGGAAAGAGCTATGTTGGAATGACATTCAAAAAATGA
GGAAAACTTGGAGCTTTGTGAATGAAGTATTAAGAAACACACCAGTTGTT
CAAGGTATTTTCAGAGAAGCAATAGAGGACTTCACTTATGAAGACTTCTA
CATACCAAAAGGATGGAAGATATATTTGAGTTTTGGAGCTACACAAAAGA
ATGGTGAATATTTTCCAAATCCTACAAAGTTTGATCCTTCAAGATTTGAA
GGAAATGGACTAGTTCCTTATACATCAGTTCCATTTGGTGGAGGACACAG
AATGTGTCCTGGAAAAGAATTTGCAAGAATATTGATTCTTGTTTTTCTTC
ATCATCTACTTAAAAATTTTAGATGGGAGCCTAAGGTTCCTTTAGAAAAA
ATACTGTATCCTTTTTTCTTACTAGCCATTCCAACAGATGGGTATCCTAT
TACCCTTTCTTCTATTTAAGTTTTTTTTTTTTTTATGAAAATAAAATGTC
AAAGTACGTTACCTAGTTAATGTTGCTTCTTCAAATTTAATGGAAGAATT
AATAATTGTTGCTTACTAAAAAAAAAAAAAAAA


No predicted BACs including this HTC sequence.

KTU3; Kazusa Tomato Unigene ver.3 (KTU3_Contig12816)  (go to MiBASE)
This is a unigene (KTU3) including this clone as an EST member.






Results of BLAST



To the top of page


Database=nr

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1025BA08gi|24745923|dbj|BAC23044.1|dbj|BAC23044.1| cytochrome P450 [Solanum tuberosum]158347494.1247628139146614740915+3
LEFL1025BA08gi|157352528|emb|CAO43634.1|emb|CAO43634.1| unnamed protein product [Vitis vinifera]158348041.93477274236145714751e-115421+3
LEFL1025BA08gi|157343066|emb|CAO66555.1|emb|CAO66555.1| unnamed protein product [Vitis vinifera]158348042.374722723421457114758e-115418+3
LEFL1025BA08gi|84514135|gb|ABC59076.1|gb|ABC59076.1| cytochrome P450 monooxygenase CYP716A12 [Medicago truncatula]158347943.974642593691457144743e-114416+3
LEFL1025BA08gi|157339440|emb|CAO43981.1|emb|CAO43981.1| unnamed protein product [Vitis vinifera]158348243.61477264342145764774e-114416+3




To the top of page


Database=UniProt

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1025BA08sp|Q50EK1|C16B1_PICSIsp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1158349339.664742844421457254892e-101369+3
LEFL1025BA08sp|Q50EK0|C16B2_PICSIsp|Q50EK0|C16B2_PICSI Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1158349739.244742864421457254892e-99363+3
LEFL1025BA08sp|Q9AXM6|T10H_TAXCUsp|Q9AXM6|T10H_TAXCU Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=11583497374732946511457264933e-78292+3
LEFL1025BA08sp|Q8W4T9|T13H_TAXCUsp|Q8W4T9|T13H_TAXCU Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1158348534.94672994781463204832e-75283+3
LEFL1025BA08sp|Q9FH76|ABAH3_ARATHsp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1158346333.474753131242145764594e-63242+3




To the top of page


Database=TAIR

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1025BA08AT5G36110.1AT5G36110.1 | Symbols: CYP716A1 | CYP716A1 (cytochrome P450, family 716, subfamily A, polypeptide 1); oxygen binding | chr5:14212607-14214843 FORWARD158347738.16477290642145794733e-101365+3
LEFL1025BA08AT5G45340.1AT5G45340.1 | Symbols: CYP707A3 | CYP707A3 (cytochrome P450, family 707, subfamily A, polypeptide 3); oxygen binding | chr5:18386204-18388136 REVERSE158346333.474753131242145764594e-64242+3
LEFL1025BA08AT3G19270.1AT3G19270.1 | Symbols: CYP707A4 | CYP707A4 (cytochrome P450, family 707, subfamily A, polypeptide 4); oxygen binding | chr3:6673891-6676406 REVERSE158346833.3345029891111454274628e-63238+3
LEFL1025BA08AT4G19230.1AT4G19230.1 | Symbols: CYP707A1 | CYP707A1 (cytochrome P450, family 707, subfamily A, polypeptide 1); oxygen binding | chr4:10521535-10523528 FORWARD158346732.294773131260146054601e-62238+3
LEFL1025BA08AT2G29090.1AT2G29090.1 | Symbols: CYP707A2 | CYP707A2 (cytochrome P450, family 707, subfamily A, polypeptide 2); oxygen binding | chr2:12502115-12506157 REVERSE158348232.0848031414631466264827e-61231+3




To the top of page


Database=RAP

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1025BA08Os07g0518500|AK099924Os07g0518500|AK099924 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002401 : E-class P450, group I;Representative_sequence AK099924158348331.654743176481448104743e-66249+3
LEFL1025BA08Os07g0519500|Os07g0519500Os07g0519500|Os07g0519500 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002401 : E-class P450, group I;Representative_sequence Os07g0519500158343032.08427289351132814241e-65248+3
LEFL1025BA08Os07g0520300|AK109627Os07g0520300|AK109627 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002403 : E-class P450, group IV;Representative_sequence AK109627158349828.994833337481466114881e-61234+3
LEFL1025BA08Os07g0518100|AK105659Os07g0518100|AK105659 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002401 : E-class P450, group I;Representative_sequence AK105659158349229.054753189901457174863e-58223+3
LEFL1025BA08Os07g0519300|AK073618Os07g0519300|AK073618 Cytochrome P450 family protein.;category III : InterPro domain-containing protein;GO_id GO:0004497 : monooxygenase activity;GO_id GO:0005506 : iron ion binding;GO_id GO:0006118 : electron transport;GO_id GO:0020037 : heme binding;InterPro_id IPR001128 : Cytochrome P450;InterPro_id IPR002401 : E-class P450, group I;Representative_sequence AK073618158340730.174012793264146323982e-55213+3




To the top of page


Database=SGN Tomato UniGene

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL1025BA08SGN-U326723SGN-U326723 Tomato 200607 #1 [4 ESTs aligned] arabidopsis/peptide: AT5G36110.1 | Symbol: None | cytochrome P450 family protein, similar to taxane 13-alpha-hydroxylase (GI:17148242) {Taxus cuspidata}; contains Pfam profile: PF00067: Cytochrome P450 | chr5:14212607-14214843 FORWARD | Aliases: MAB16.5, MAB16_5 (evalue: 7e-101, score=364) genbank/nr: gi|24745923|dbj|BAC23044.1| cytochrome P450 [Solanum tuberosum](evalue: 0, score=912)1583157599.741553403115831155303047Plus
LEFL1025BA08SGN-U335261SGN-U335261 Tomato 200607 #1 [1 ESTs aligned] genbank/nr: alpha-peptide(evalue: 5e-13, score=77.8)158344794.123420147315064474140.0000152Minus




To the top of page


Database=DFCI Tomato Gene Index

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL1025BA08TC203509TC203509 homologue to UniRef100_Q8H9C5 Cluster: Cytochrome P450; n=1; Solanum tuberosum|Rep: Cytochrome P450 - Solanum tuberosum (Potato), partial (41%)158359199.835911037627159101164Plus
LEFL1025BA08AW650965AW650965 homologue to UniRef100_Q8H9C5 Cluster: Cytochrome P450; n=1; Solanum tuberosum|Rep: Cytochrome P450 - Solanum tuberosum (Potato), partial (32%)158346299.7846210718117914620910Plus






Results of InterProScan



To the top of page


SEQUENCE: LEFL1025BA08_1_ORF2 CRC64: 0DE2FD782B78FAC6 LENGTH: 104 aa
>LEFL1025BA08_1_ORF2 Translation of LEFL1025BA08 in frame 1, ORF 2, threshold 50, 104aa
LQAPLVGLLLEKPSNSFFHFTMDWSMSLFKKEPKNTTLMYSKPHYLAKKLLFFQVQQLTN
SYSLKVISLSLVGDLSLFKSSSHQHHLSLLNMTLKGHIMSLAIF
noIPR
unintegrated
unintegrated
seg [75-90]? NA seg seg seg

SEQUENCE: LEFL1025BA08_1_ORF2 CRC64: 0DE2FD782B78FAC6 LENGTH: 104 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [75-90]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL1025BA08_3_ORF2 CRC64: 41972CA0A1852F7D LENGTH: 480 aa
>LEFL1025BA08_3_ORF2 Translation of LEFL1025BA08 in frame 3, ORF 2, threshold 50, 480aa
HTKMDLFLLSFATTLTIIIYSLFKYFFAKPKEKMPLAPGTFGWPIIGETIQFLFSLYYGL
VHEFVQERTKKYNSHVFKTSLLGQKVVVFSGPAANKFIFTQGNKLIIGWRPKSVQKLFPS
TSFVPIEHDTKRAHNVISYFLNSQNVERLISTMENMSHLHLKNHWKGKNEVMVYDQVKLF
TFSLSIRAFMGIEDSDKILNLYEKFKIFTQGLLAVDINLPGTTFYKAMKAGNELRKQMKV
IIKQRRVELFENPNLSKVDVLTQMINEQDEDGKYMTEVEIEDKVFGFIIGSYDTTATTIT
LTMKYLQQMPEFFNEIIQEQNEISRQMMPRKELCWNDIQKMRKTWSFVNEVLRNTPVVQG
IFREAIEDFTYEDFYIPKGWKIYLSFGATQKNGEYFPNPTKFDPSRFEGNGLVPYTSVPF
GGGHRMCPGKEFARILILVFLHHLLKNFRWEPKVPLEKILYPFFLLAIPTDGYPITLSSI
InterPro
IPR001128
Family
Cytochrome P450
PR00385 [290-307]T 1.9e-07 PR00385 P450[346-357]T 1.9e-07 PR00385 P450[418-427]T 1.9e-07 PR00385 P450[427-438]T 1.9e-07 PR00385 P450 P450
G3DSA:1.10.630.10 [22-477]T 2.6e-81 G3DSA:1.10.630.10 no description no description
PTHR19383 [6-448]T 1.8e-219 PTHR19383 CYTOCHROME P450 CYTOCHROME P450
PF00067 [219-477]T 2.5e-43 PF00067 p450 p450
PS00086 [420-429]? NA PS00086 CYTOCHROME_P450 CYTOCHROME_P450
SSF48264 [37-477]T 3.5e-89 SSF48264 Cytochrome P450 Cytochrome P450
InterPro
IPR002401
Family
Cytochrome P450, E-class, group I
PR00463 [385-409]T 1e-08 PR00463 EP450I[417-427]T 1e-08 PR00463 EP450I[427-450]T 1e-08 PR00463 EP450I EP450I
noIPR
unintegrated
unintegrated
PTHR19383:SF25 [6-448]T 1.8e-219 PTHR19383:SF25 CYTOCHROME P450 CYTOCHROME P450

SEQUENCE: LEFL1025BA08_3_ORF2 CRC64: 41972CA0A1852F7D LENGTH: 480 aa
InterPro
IPR001128
Family
Cytochrome P450
PRINTSPR00385P450
 1.9e-07 [290-307]T   1.9e-07 [346-357]T   1.9e-07 [418-427]T   1.9e-07 [427-438]T 
GENE3DG3DSA:1.10.630.10no description
 2.6e-81 [22-477]T       
PANTHERPTHR19383CYTOCHROME P450
 1.8e-219 [6-448]T       
PFAMPF00067p450
 2.5e-43 [219-477]T       
PROSITEPS00086CYTOCHROME_P450
 NA [420-429]?       
SUPERFAMILYSSF48264Cytochrome P450
 3.5e-89 [37-477]T       
Parent no parent
Children IPR002397 IPR002399 IPR002401 IPR002402 IPR002403
Found in no entries
Contains no entries
GO terms Molecular Function: monooxygenase activity (GO:0004497)
Molecular Function: iron ion binding (GO:0005506)
Biological Process: electron transport (GO:0006118)
Molecular Function: heme binding (GO:0020037)
InterPro
IPR002401
Family
Cytochrome P450, E-class, group I
PRINTSPR00463EP450I
 1e-08 [385-409]T   1e-08 [417-427]T   1e-08 [427-450]T   
Parent IPR001128
Children IPR002949 IPR002974 IPR008066 IPR008067 IPR008068 IPR008069 IPR008070 IPR008071 IPR008072
Found in no entries
Contains no entries
GO terms Molecular Function: monooxygenase activity (GO:0004497)
Molecular Function: iron ion binding (GO:0005506)
Biological Process: electron transport (GO:0006118)
Molecular Function: heme binding (GO:0020037)
noIPR
unintegrated
unintegrated
PANTHERPTHR19383:SF25CYTOCHROME P450
 1.8e-219 [6-448]T       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL1025BA08_5_ORF2 CRC64: 323036244FBCD197 LENGTH: 66 aa
>LEFL1025BA08_5_ORF2 Translation of LEFL1025BA08 in frame 5, ORF 2, threshold 50, 66aa
LPIMKPNTLSSISTSVMYFPSSSCSLIICVNTSTFDKFGFSNNSTLLCLIITFICFLNSF
PAFIAL
noIPR
unintegrated
unintegrated
seg [45-57]? NA seg seg seg

SEQUENCE: LEFL1025BA08_5_ORF2 CRC64: 323036244FBCD197 LENGTH: 66 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [45-57]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL1025BA08_6_ORF2 CRC64: 132B0B6FAB2437F6 LENGTH: 52 aa
>LEFL1025BA08_6_ORF2 Translation of LEFL1025BA08 in frame 6, ORF 2, threshold 50, 52aa
RIKLCRIWKIFTILLCSSKTQIYLPSFWYVEVFISEVLYCFSENTLNNWCVS
No hits reported.

SEQUENCE: LEFL1025BA08_6_ORF3 CRC64: AD38292B23A4CB12 LENGTH: 67 aa
>LEFL1025BA08_6_ORF3 Translation of LEFL1025BA08 in frame 6, ORF 3, threshold 50, 67aa
YLILLLNYFIEELRHLLKVLHGQSNSCSSSIITTNNEAKHFILYFNFSHVLSIFILFIDH
LCQHINF
noIPR
unintegrated
unintegrated
seg [24-36]? NA seg seg seg

SEQUENCE: LEFL1025BA08_6_ORF3 CRC64: AD38292B23A4CB12 LENGTH: 67 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [24-36]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL1025BA08_6_ORF4 CRC64: D8626099B16EC07A LENGTH: 54 aa
>LEFL1025BA08_6_ORF4 Translation of LEFL1025BA08 in frame 6, ORF 4, threshold 50, 54aa
FIPSFHCLIKCCARKIYVHCQKTLCKNLEFFIKIQDFIRILDPHKGSNRKGESE
No hits reported.