LEFL1002CA07      To the result of BLAST   To the result of InterProScanTo Home
DDBJ Acc. number
AK319822


>LEFL1002CA07
AAGAAACCAATTCAAAAGAGACCAAAACCCTTACTACACTTTGAAATTTT
GCAAAAAAATATGACCACAAAAGAGATGGAAGTAGTAAAGAATTTGGATG
TTGAAAAATACATGGGAAGATGGTATGAAATTGCCTCATTTCCATCAAGA
AATCAACCAAAAGATGGTGTAAACACAAGAGCCACTTACACTTTAAACCA
AGATGGAACAGTACATGTGTTAAATGAAACATGGAGTGGTGGTAAAAGAG
GTTCAATTGAAGGGACTGCCTATAAAGCTGATCCAAAAAGTGATGAAGCA
AAACTTAAAGTGAAATTTTATATCCCACCTTTCTTGCCAATTATTCCTAT
TGTTGGTGATTATTGGGTTTTATATATTGATGATGATTATCAATATGCTT
TGATTGGTCAGCCTAGTAAGAAATATCTTTGGATATTATGTAGGCAACCA
CATCTTGATGAAGAAATATACAACCAACTTGTTGAGAAGGCAAAAGAAGT
AGGATATGATGTGAGCAAACTTCACAAGACACCTCAAGCTGATCCTCCAC
CAGATGGTGAAGATGCCCCAAAGGACACTAAAGGATTTTGGTGGATCAAA
TCAATATTGGGAAAATAGTCAATCTTGAATATGGTTTTTTTAAAACCAAT
AGCTAAATAAATTTTACAATATAAATTATGAAAAGTTGTCTTGTAAAGAA
GAGTTTAATATTGTTTATATTTCAAATGTTGTAAATTTCTAAGGTGTGTC
CTTCTTGTGTTGGTAGTAAGTATAGCATGTGTAATATTGTGTTGTTGCAA
CTTATAAGAGAGTTTGTTGTTAATTTTACAATATAAATTATGAAATGTTG
AATATATATAGTTTGTTTCTTCCAAAAAAAAAAAAAAAA


HTC vs BAC (C07HBa0002D20.1)
This is a predicted BAC including this HTC sequence.

KTU3; Kazusa Tomato Unigene ver.3 (KTU3_Contig27073)  (go to MiBASE)
This is a unigene (KTU3) including this clone as an EST member.






Results of BLAST



To the top of page


Database=nr

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1002CA07gi|77744859|gb|ABB02383.1|gb|ABB02383.1| temperature-induced lipocalin' [Lycopersicon esculentum]889185100185006161511859e-108393+1
LEFL1002CA07gi|77744865|gb|ABB02386.1|gb|ABB02386.1| temperature-induced lipocalin' [Solanum tuberosum]88918698.39186216161511863e-105385+1
LEFL1002CA07gi|77744873|gb|ABB02390.1|gb|ABB02390.1| temperature-induced lipocalin [Lycopersicon esculentum]88918584.321852906161511853e-91338+1
LEFL1002CA07gi|77744897|gb|ABB02402.1|gb|ABB02402.1| temperature-induced lipocalin [Gossypium arboreum]88918581.521843406161211841e-90336+1
LEFL1002CA07gi|77744871|gb|ABB02389.1|gb|ABB02389.1| temperature-induced lipocalin' [Populus balsamifera]///gb|ACJ02357.1| temperature-induced lipocalin [Populus tremula x Populus alba]88918582.611843216461531852e-90335+1




To the top of page


Database=UniProt

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1002CA07sp|Q46036|BLC_CITFRsp|Q46036|BLC_CITFR Outer membrane lipoprotein blc OS=Citrobacter freundii PE=3 SV=188917736.3615495570522261692e-1892.8+1
LEFL1002CA07sp|P0A901|BLC_ECOLIsp|P0A901|BLC_ECOLI Outer membrane lipoprotein blc OS=Escherichia coli (strain K12) GN=blc PE=1 SV=188917736.4914892482519301681e-1790.5+1
LEFL1002CA07sp|P0A902|BLC_ECO57sp|P0A902|BLC_ECO57 Outer membrane lipoprotein blc OS=Escherichia coli O157:H7 GN=blc PE=3 SV=188917736.4914892482519301681e-1790.5+1
LEFL1002CA07sp|Q5URA7|YR877_MIMIVsp|Q5URA7|YR877_MIMIV Putative lipocalin R877 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R877 PE=1 SV=188916936.314691491522271660.00000000000000382.4+1
LEFL1002CA07sp|P51910|APOD_MOUSEsp|P51910|APOD_MOUSE Apolipoprotein D OS=Mus musculus GN=Apod PE=2 SV=188918934.7616499782549331860.00000000000000781.3+1




To the top of page


Database=TAIR

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1002CA07AT5G58070.1AT5G58070.1 | Symbols: | lipocalin, putative | chr5:23517738-23518382 REVERSE88918677.471824107061551861e-84309+1
LEFL1002CA07AT3G47860.1AT3G47860.1 | Symbols: | apolipoprotein D-related | chr3:17667763-17669254 REVERSE88935327.781801087885611323050.000000452.4+1




To the top of page


Database=RAP

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreFrame
LEFL1002CA07Os08g0440100|AK068551Os08g0440100|AK068551 Similar to Temperature stress-induced lipocalin.;category II : Similar to known protein;GO_id GO:0005215 : transporter activity;GO_id GO:0005488 : binding;GO_id GO:0006810 : transport;InterPro_id IPR002446 : Lipocalin, bacterial and plant;InterPro_id IPR012674 : Calycin;InterPro_id IPR013208 : Lipocalin-like;InterPro_id IPR002345 : Lipocalin;InterPro_id IPR011038 : Calycin-like;Representative_sequence AK06855188917972.781804917661511792e-78289+1
LEFL1002CA07Os02g0612900|AK071108Os02g0612900|AK071108 Similar to Temperature stress-induced lipocalin.;category II : Similar to known protein;GO_id GO:0005488 : binding;GO_id GO:0006810 : transport;GO_id GO:0008289 : lipid binding;InterPro_id IPR002969 : Apolipoprotein D;InterPro_id IPR012674 : Calycin;InterPro_id IPR013208 : Lipocalin-like;InterPro_id IPR011038 : Calycin-like;Representative_sequence AK07110888919571.0418351273615131952e-75279+1
LEFL1002CA07Os04g0626400|AK059851Os04g0626400|AK059851 Calycin-like family protein.;category III : InterPro domain-containing protein;GO_id GO:0005215 : transporter activity;GO_id GO:0005488 : binding;GO_id GO:0006810 : transport;InterPro_id IPR012674 : Calycin;InterPro_id IPR000566 : Lipocalin-related protein and Bos/Can/Equ allergen;InterPro_id IPR002345 : Lipocalin;InterPro_id IPR011038 : Calycin-like;Representative_sequence AK05985188934227.571851136465371122850.000000352.8+1




To the top of page


Database=SGN Tomato UniGene

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL1002CA07SGN-U317113SGN-U317113 Tomato 200607 #1 [21 ESTs aligned] arabidopsis/peptide: | Symbol: None | lipocalin, putative, similar to temperature stress-induced lipocalin (Triticum aestivum) GI:18650668 | chr5:23517287-23518435 REVERSE | Aliases: K21L19.9, K21L19_9(evalue: 6e-77, score=284) genbank/nr: temperature-induced(evalue: 4e-100, score=367)88991898.658919218891690501657Plus
LEFL1002CA07SGN-U335957SGN-U335957 Tomato 200607 #1 [1 ESTs aligned] arabidopsis/peptide: | Symbol: None | lipocalin, putative, similar to temperature stress-induced lipocalin (Triticum aestivum) GI:18650668 | chr5:23517287-23518435 REVERSE | Aliases: K21L19.9, K21L19_9(evalue: 3e-43, score=172) genbank/nr: temperature-induced(evalue: 1e-55, score=219)88966193.23620402238856659410880Minus
LEFL1002CA07SGN-U335958SGN-U335958 Tomato 200607 #1 [1 ESTs aligned] arabidopsis/peptide: | Symbol: None | lipocalin, putative, similar to temperature stress-induced lipocalin (Triticum aestivum) GI:18650668 | chr5:23517287-23518435 REVERSE | Aliases: K21L19.9, K21L19_9(evalue: 1e-15, score=80.5) genbank/nr: temperature-induced(evalue: 5e-25, score=117)88956291.73423341433855469486e-157553Minus
LEFL1002CA07SGN-U313836SGN-U313836 Tomato 200607 #1 [28 ESTs aligned] arabidopsis/peptide: | Symbol: None | lipocalin, putative, similar to temperature stress-induced lipocalin (Triticum aestivum) GI:18650668 | chr5:23517287-23518435 REVERSE | Aliases: K21L19.9, K21L19_9(evalue: 5e-80, score=295) genbank/nr: temperature-induced(evalue: 4e-95, score=352)889152683.0750884211261850110071e-83309Plus
LEFL1002CA07SGN-U334619SGN-U334619 Tomato 200607 #1 [1 ESTs aligned] arabidopsis/peptide: | Symbol: None | lipocalin, putative, similar to temperature stress-induced lipocalin (Triticum aestivum) GI:18650668 | chr5:23517287-23518435 REVERSE | Aliases: K21L19.9, K21L19_9(evalue: 2e-11, score=67) genbank/nr: temperature-induced(evalue: 4e-16, score=89)88982883.921432214325736868282e-1893.7Plus




To the top of page


Database=DFCI Tomato Gene Index

no alignment

clone homologous sequence description clone length homologous sequence length Identities(%) Match length Mismatches Gap openings clone start clone end homologous sequence start homologous sequence end E-value bit ScoreStrand
LEFL1002CA07TC195409TC195409 UniRef100_Q38JE1 Cluster: Temperature-induced lipocalin'; n=1; Solanum lycopersicum|Rep: Temperature-induced lipocalin' - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), complete88985499.1481561558698443101552Minus
LEFL1002CA07TC194988TC194988 UniRef100_Q38JE1 Cluster: Temperature-induced lipocalin'; n=1; Solanum lycopersicum|Rep: Temperature-induced lipocalin' - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), complete88978799.627871120804178701530Plus
LEFL1002CA07TC214986TC214986 UniRef100_Q38JE1 Cluster: Temperature-induced lipocalin'; n=1; Solanum lycopersicum|Rep: Temperature-induced lipocalin' - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), partial (98%)88974997.71612122263114974901108Plus
LEFL1002CA07TC206307TC206307 UniRef100_Q38JD4 Cluster: Temperature-induced lipocalin; n=1; Solanum lycopersicum|Rep: Temperature-induced lipocalin - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), complete88994183.075088421126181876932e-83309Plus
LEFL1002CA07TC192944TC192944 UniRef100_Q38JD4 Cluster: Temperature-induced lipocalin; n=1; Solanum lycopersicum|Rep: Temperature-induced lipocalin - Solanum lycopersicum (Tomato) (Lycopersicon esculentum), complete88980383.075088421126181576632e-83309Plus






Results of InterProScan



To the top of page


SEQUENCE: LEFL1002CA07_1_ORF1 CRC64: 39EA3F464F5A1BE9 LENGTH: 205 aa
>LEFL1002CA07_1_ORF1 Translation of LEFL1002CA07 in frame 1, ORF 1, threshold 50, 205aa
KKPIQKRPKPLLHFEILQKNMTTKEMEVVKNLDVEKYMGRWYEIASFPSRNQPKDGVNTR
ATYTLNQDGTVHVLNETWSGGKRGSIEGTAYKADPKSDEAKLKVKFYIPPFLPIIPIVGD
YWVLYIDDDYQYALIGQPSKKYLWILCRQPHLDEEIYNQLVEKAKEVGYDVSKLHKTPQA
DPPPDGEDAPKDTKGFWWIKSILGK
InterPro
IPR002345
Domain
Lipocalin
PS00213 [31-44]T 8e-5 PS00213 LIPOCALIN LIPOCALIN
InterPro
IPR002446
Domain
Lipocalin, bacterial and plant
PR01171 [32-46]T 7.2e-07 PR01171 BCTLIPOCALIN[69-78]T 7.2e-07 PR01171 BCTLIPOCALIN[141-152]T 7.2e-07 PR01171 BCTLIPOCALIN[168-178]T 7.2e-07 PR01171 BCTLIPOCALIN BCTLIPOCALIN
InterPro
IPR011038
Domain
Calycin-like
SSF50814 [11-187]T 3.9e-46 SSF50814 Lipocalins Lipocalins
InterPro
IPR012674
Domain
Calycin
G3DSA:2.40.128.20 [11-182]T 7.5e-51 G3DSA:2.40.128.20 no description no description
InterPro
IPR013208
Domain
Lipocalin-like
PF08212 [32-179]T 4.1e-81 PF08212 Lipocalin_2 Lipocalin_2
noIPR
unintegrated
unintegrated
PIRSF036893 [1-188]T 1.7e-53 PIRSF036893 Lipocalin, ApoD type Lipocalin, ApoD type
seg [108-117]? NA seg seg seg

SEQUENCE: LEFL1002CA07_1_ORF1 CRC64: 39EA3F464F5A1BE9 LENGTH: 205 aa
InterPro
IPR002345
Domain
Lipocalin
PROSITEPS00213LIPOCALIN
 8e-5 [31-44]T       
Parent IPR000566
Children IPR002446 IPR002448 IPR002449 IPR002968 IPR002969 IPR002971 IPR002972 IPR003057 IPR003087
Found in IPR002447
Contains no entries
GO terms Molecular Function: transporter activity (GO:0005215)
Molecular Function: binding (GO:0005488)
Biological Process: transport (GO:0006810)
InterPro
IPR002446
Domain
Lipocalin, bacterial and plant
PRINTSPR01171BCTLIPOCALIN
 7.2e-07 [32-46]T   7.2e-07 [69-78]T   7.2e-07 [141-152]T   7.2e-07 [168-178]T 
Parent IPR002345
Children no children
Found in no entries
Contains no entries
GO terms Molecular Function: transporter activity (GO:0005215)
Molecular Function: binding (GO:0005488)
Biological Process: transport (GO:0006810)
InterPro
IPR011038
Domain
Calycin-like
SUPERFAMILYSSF50814Lipocalins
 3.9e-46 [11-187]T       
Parent no parent
Children IPR012674
Found in IPR002970 IPR011569 IPR015231
Contains no entries
GO terms none
InterPro
IPR012674
Domain
Calycin
GENE3DG3DSA:2.40.128.20no description
 7.5e-51 [11-182]T       
Parent IPR011038
Children IPR000566 IPR010788 IPR011586 IPR013208 IPR015304
Found in IPR005657
Contains no entries
GO terms Molecular Function: binding (GO:0005488)
InterPro
IPR013208
Domain
Lipocalin-like
PFAMPF08212Lipocalin_2
 4.1e-81 [32-179]T       
Parent IPR012674
Children no children
Found in no entries
Contains no entries
GO terms none
noIPR
unintegrated
unintegrated
PIRPIRSF036893Lipocalin, ApoD type
 1.7e-53 [1-188]T       
SEGseg seg
 NA [108-117]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL1002CA07_4_ORF2 CRC64: B133DE6C92513C44 LENGTH: 54 aa
>LEFL1002CA07_4_ORF2 Translation of LEFL1002CA07 in frame 4, ORF 2, threshold 50, 54aa
FDPPKSFSVLWGIFTIWWRISLRCLVKFAHIISYFFCLLNKLVVYFFIKMWLPT
No hits reported.

SEQUENCE: LEFL1002CA07_5_ORF1 CRC64: E64C3FD5F4412181 LENGTH: 55 aa
>LEFL1002CA07_5_ORF1 Translation of LEFL1002CA07 in frame 5, ORF 1, threshold 50, 55aa
FFFFFWKKQTIYIQHFIIYIVKLTTNSLISCNNTILHMLYLLPTQEGHTLEIYNI
No hits reported.

SEQUENCE: LEFL1002CA07_5_ORF2 CRC64: 8A5F1E6E3E2A5979 LENGTH: 54 aa
>LEFL1002CA07_5_ORF2 Translation of LEFL1002CA07 in frame 5, ORF 2, threshold 50, 54aa
CPLGHLHHLVEDQLEVSCEVCSHHILLLLPSQQVGCIFLHQDVVAYIISKDISY
No hits reported.

SEQUENCE: LEFL1002CA07_5_ORF3 CRC64: 34E70B32180613C8 LENGTH: 101 aa
>LEFL1002CA07_5_ORF3 Translation of LEFL1002CA07 in frame 5, ORF 3, threshold 50, 102aa
VLLHHFLDQLYRQSLQLNLFYHHSMFHLTHVLFHLGLKCKWLLCLHHLLVDFLMEMRQFH
TIFPCIFQHPNSLLLPSLLWSYFFAKFQSVVRVLVSFELVS
noIPR
unintegrated
unintegrated
seg [34-49]? NA seg seg[72-81]? NA seg seg seg

SEQUENCE: LEFL1002CA07_5_ORF3 CRC64: 34E70B32180613C8 LENGTH: 101 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [34-49]?   NA [72-81]?     
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL1002CA07_6_ORF1 CRC64: 3474DC1F73DA12BB LENGTH: 60 aa
>LEFL1002CA07_6_ORF1 Translation of LEFL1002CA07 in frame 6, ORF 1, threshold 50, 60aa
FFFFLEETNYIYSTFHNLYCKINNKLSYKLQQHNITHAILTTNTRRTHLRNLQHLKYKQY
noIPR
unintegrated
unintegrated
seg [40-52]? NA seg seg seg

SEQUENCE: LEFL1002CA07_6_ORF1 CRC64: 3474DC1F73DA12BB LENGTH: 60 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [40-52]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

SEQUENCE: LEFL1002CA07_6_ORF2 CRC64: C399CE340392836F LENGTH: 56 aa
>LEFL1002CA07_6_ORF2 Translation of LEFL1002CA07 in frame 6, ORF 2, threshold 50, 56aa
TLLYKTTFHNLYCKIYLAIGFKKTIFKIDYFPNIDLIHQNPLVSFGASSPSGGGSA
noIPR
unintegrated
unintegrated
seg [46-56]? NA seg seg seg

SEQUENCE: LEFL1002CA07_6_ORF2 CRC64: C399CE340392836F LENGTH: 56 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [46-56]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none